Announcement

Collapse
No announcement yet.

mallards

Collapse
X
 
  • Filter
  • Time
  • Show
Clear All
new posts

  • mallards

    flu-evolution in mallards is different from that in poultry or mammals

    flu in mallards (and pintails,shovelers,teals,widgeons,guillemots,...)
    have an almost fixed amino-acid sequence in the inner segments.
    It presumably dominantly spreads by water and often developes fewer
    nucleotide mutations as well.
    So the calculations to examine most-recent-common-ancestor-dates
    from mallard-sequences are to be taken carefully.
    You often won't see the typical mutation-acquiring behaviour that
    we are used to see from mammalean or poultry flu.
    (see e.g. the thread about slow evolution in Chinese birds)

    flu usually goes from mallards to other species, where it my set foot
    and evolve (i.e. in the inner segments) separately for decades,centuries
    and then die out, to get replaced by new (mallard-) strains.

    We have no example that flu went back from poultry or mammals
    to mallards in an evolution changing manner.
    Mallards maintain their own, fundamental, index-close sequences
    in the inner segments and a big variety in the 16 HAs and 9 NAs
    and frequent reassortments. Occasionally (~~once per century ?)
    west-mallard-flu (America) mixes with East-mallard-flu (Europe,Asia,
    Oceania,Africa), but typically they are separated
    These mixing events are potentially dangerous in forming
    reassortments and new pandemic strains.

    --------------------------------------------
    searching pubmed for influenza,evolution,mallards
    -----------------------------------------------------------
    Phylogenetic analyses confirm two mitochondrial mallard clades. Genetic differentiation
    within Eurasia and North-America is low, on a continental scale, but large differences
    occur between these two land masses (F(ST) = 0.51).
    a split between Eurasia and North-America 43,000 to 74,000 years ago
    and strong population growth (~100fold) since then and little migration
    (not statistically different from zero).
    Based on this first complete assessment of the mallard's world-wide population genetic
    structure we confirm that no more than two mtDNA clades exist. Clade A is characteristic
    for Eurasia, and clade B for North-America although some representatives of clade A are
    also found in North-America.
    ---------------------------------------------------
    (Minnesota,H3N8,H4N6)
    The viruses persisted in water for an extended time period at constant temperature
    (several weeks) but infectivity rapidly reduced under multiple freeze-thaw cycles
    ----------------------------------------------------
    A/mallard/Poland/446/09 (detected in December 2009) shared a recent common ancestor with
    A/mallard/Poland/41/09 (isolated in February 2009) in relation to HA and PB1 genes, with
    A/mallard/Poland/16/09 (found in January 2009) regarding NA and NS genes, and with
    A/mallard/Poland/01/08 (recovered in December 2007) as regards the NS gene. Interestingly,
    A/mallard/Poland/16/09 and A/mallard/Poland/446/09 were isolated at the same sampling site almost
    exactly 1 year apart, which points to resident population of mallards (and other resident waterfowl)
    ---------------------------------------------------------------

    they should test normal current human-flu viruses HA,NA, also H5N1 and the 6 inner segments from
    the mallard-index in ferrets
    5,1,3,2,1,1 A/NL/219/2003(H7N7)
    8,7,10,9,7,5 A/BM/1/1918(H1N1)


    --------------------------------------------------------------------------------------

    Wild ducks of the genus Anas represent the natural hosts for a large genetic diversity of influenza A viruses. In these hosts, co-infections with different virus genotypes are frequent and result in high rates of genetic reassortment. Recent genomic data have provided information regarding the patte …

    The mallard Anas platyrhynchos is a reservoir species for influenza A virus in the northern hemisphere, with particularly high prevalence rates prior to as well as during its prolonged autumn migration. It has been proposed that the virus is brought ...


    A/Mallard/MN/Sg-00169/2007 (H3N8); A/Mallard/MN/Sg-00219/2007 (H4N8); A/Mallard/MN/Sg-00170/2007 (H6N1); A/Mallard/MN/Sg-00107/2007 (H6N2); A/Green-winged teal/MN/Sg-00197/2007 (H6N8) (referred to hereafter as their respective subtype). Relative abundance of the five virus subtypes (i.e. prevalence ± 95% confidence intervals) in the waterfowl population at the sampling site was 22.5 ± 9.7% (H3N8), 9.9 ± 6.9% (H6N1), 5.6 ± 5.4% (H6N2), 2.8 ± 3.9% (H6N8) and 1.4 ± 2.7% (H4N8) (cf. [27] for details).

    13,3322,0,2,7,2,-,2
    23,3365,5,3,6,2,1,6
    13,3295,1,2,8,1,-,-*
    15,3298,0,4,6,2,-,-*
    18,3335,2,2,4,1,7,-

    --------------------------------------------------------
    I'm interested in expert panflu damage estimates
    my current links: http://bit.ly/hFI7H ILI-charts: http://bit.ly/CcRgT

  • #2
    Re: mallards

    ducks in Asia
    ==========

    Wild dabbling ducks (genus Anas) are the main reservoir for influenza A virus (IAV) in the Northern Hemisphere. Current understanding of disease dynamics and epidemiology in this virus-host system has primarily been based on population-level surveillance studies and infection experiments conducted i …

    strong tendency for long-lasting hemagglutinin-related homosubtypic immunity in mallards
    -------------------------------------------------------------------
    To elucidate the origin and genetic structure of the domesticated duck in Eurasia and North America, we sequenced 114 duck D-loop sequences and retrieved 489 D-loop sequences from GenBank. In total, 603 ducks including 50 duck breeds/populations from eight countries (China, France, Russia, India, Ka …

    mallards:134 haplotypes
    No geography, breed or population clusters in Eurasian domestic ducks and mallards.
    5 haplotypes were shared by USA mallards and Eurasian domestic duck/Eurasian mallards.
    1 haplotype (H49) was shared by Eurasian ducks and China spot-billed ducks.
    (i) Eurasian and North American mallards show a clear geographic distribution pattern;
    (ii) Eurasian domestic ducks are derived from the Eurasian mallards, not from the spot-billed ducks.
    -----------------------------------------------------------------------------------------------
    China is particularly rich in duck genetic resources. In order to reveal the genetic diversity and origin of Chinese domestic duck, the 667 bp control region of mitochondrial DNA of 238 domestic ducks from 26 indigenous breeds, 25 wild mallards and nine spot-billed ducks were sequenced and analyzed …

    China is particularly rich in duck genetic resources.
    low genetic diversity of Chinese domestic ducks
    Chinese domestic ducks mainly derived from mallards, few from spot-billed duck
    ----------------------------------------------------------------------------------------------------
    It is a fact that in Viet Nam, Muscovy ducks are raised in large populations (approximately 8 million), usually kept in small flocks together with mallards and chickens. As a result, it is a great concern for epidemiologists to elucidate possible differences in relation to these species being expose …

    mortality of several H5N1 in Vietnam Muscovy ducks > 80%, 0%-100% in mallards
    high titers in muscovy brains
    ------------------------------------------------------------------------------------------------
    Live bird markets (LBMs) provide an ideal environment for the evolution and interspecies transfer of avian influenza viruses (AIVs). In this study, we analyzed AIVs present in LBMs in Korea during the winter seasons of 2006-08. Sixty-five AIVs that belong to four hemagglutination (HA) subtypes ofAIV …

    Live Bird Markets in Korea during the winter seasons of 2006-08.
    Phylogenetic analysis suggests that the Korean H9N2 viruses prevalent in chickens
    have provided their gene segments to AIVs circulating in ducks
    ------------------------------------------------------------------------------------------------------
    The pathobiology of H5N1 high-pathogenicity avian influenza (HPAI) virus infection in wild waterfowl is poorly understood. This study examined the pathobiology of A/chicken/Korea/IS/06 (H5N1) HPAI in 5 migratory waterfowl species--mute swans (Cygnus olor), greylag geese (Anser anser), ruddy shelduck …

    mortality of H5N1 in 5 migratory species : mute swans(100%),greylag geese(0%,but severe),
    ruddy shelducks(100%),mandarin ducks(~5%),mallards(asymptomatic)
    -------------------------------------------------------------------------------------------------------------
    Virological, molecular and serological studies were carried out to determine the status of infections with avian influenza viruses (AIV) in different species of wild waterbirds in Iran during 2003-2007. Samples were collected from 1146 birds ...

    avian flu in Iran (mainly Kaspian sea area) : Mallard(43%), Common Teal(26%), Common Pochard,
    Northern Shoveler and Eurasian Wigeon
    ---------------------------------------------------------------------------------------------------------------
    A number of H5N1 influenza outbreaks have occurred in aquatic birds in Asia. As aquatic birds are the natural reservoir of influenza A viruses and do not usually show clinical disease upon infection, the repeated H5N1 outbreaks have highlighted the importance of continuous surveillance on H5N1 virus …

    differences in H5N1 pathogenicity in mallards induced by HA-cleavage site ?
    ----------------------------------------------------------------------------------------------------------------
    Wild birds, in particular waterfowl, are common reservoirs of low pathogenic avian influenza viruses, and infected individuals could spread the viruses during migrations. We used satellite telemetry to track the spring migration of the mallard ducks ( Anas platyrhynchos ) that winter in Japan. We st …

    tracking mallards wintering in Japan
    typically stayed 1-4 weeks at a site between migration intervals of 2-3 days.
    Stopover sites: NE-Japan, E-Korea,farE-Russia.
    terminal breeding sites in NEAsia and farE-Russia
    ----------------------------------------------------------------------------------------------------------------
    The results indicated that mallard, which possesses huge population size and world wide distribution, could be considered one of the most important natural carrier of AIV and NDV and may have more important ecological significance on viruses transmission than other species of wild birds.

    mallards Heilongjiang Oct. 2006
    H2N2:2,H2N6:2,H3N4,H3N6:2,H3N7:2,H3N8:2,H6N2:2,H11 N2,H11N3,H11N5:2,H11N6,garganey-H5N2
    ------------------------------------------------------------------------------
    Our results showed that unlike other domesticated farm animals in China such as chicken, cattle, goat, and yak with multiple matrilineal components, the matrilineal pool of Chinese ducks was homogenous.

    China, has 30 unique breeds diverse duck genetic pool
    China, with around 30 unique breeds, has a diverse duck genetic pool. Currently, there is no systematic report which investigates the genetic diversity, phylogenetic relationship, and matrilineal genetic structure of these domestic breeds and wild ...

    All domestic duck and wild mallard haplotypes were essentially indistinguishable
    and were clustered together in the phylogenetic tree. There was no geographic
    differentiation and breed/population-specific distribution of duck lineages.
    ------------------------------------------------------------------------------------------------
    Wild birds have been implicated in the expansion of highly pathogenic avian influenza virus (H5N1) outbreaks across Asia, the Middle East, Europe, and Africa (in addition to traditional transmission by infected poultry, contaminated equipment, and people). Such a role would require wild birds to exc …

    tufted ducks, Eurasian pochards, and mallards excreted significantly more virus
    than common teals, Eurasian wigeons, and gadwalls; yet only tufted ducks and,
    to a lesser degree, pochards became ill or died.
    -------------------------------------------------------------------------------------------
    Wild waterfowl are the natural reservoir of all influenza A viruses, and these viruses are usually nonpathogenic in these birds. However, since late 2002, H5N1 outbreaks in Asia have resulted in mortality among waterfowl in recreational parks, domestic flocks, and wild migratory birds. The evolution …

    juvenile mallards with 23 different H5N1, replicated well, 22 transmitted
    trachea more than cloaca
    -------------------------------------------------------------------------------------------
    Waterfowl are the natural reservoir of all influenza A viruses, which are usually nonpathogenic in wild aquatic birds. However, in late 2002, outbreaks of highly pathogenic H5N1 influenza virus caused deaths among wild migratory birds and resident waterfowl, including ducks, in two Hong Kong parks. …

    new 2002-H5N1 caused systemic infection in ducks, with high titers and multiorgan pathology,i.e. brain.
    High titers in the birds' drinking water. In contrast, H5N1 1997-2001 were not well transmitted and
    did not cause significant disease.
    -------------------------------------------------------------------------------------------
    1980-1983,San-in W-Japan
    8/354 faeces whistling swans; 0/261 black-tailed gulls, 0/113 pintails ,0/10 mallards
    5/8 H2, 2 H7, 1 H4
    H13N1,H11N6 from 465 fecal samples from pintails, 0/255 whistling swans, 0/625 black-tailed gulls
    17/1156 , 10 H7N3, 2 H1N6 and 2 H3N8, from 459 whistling swans. 2, H13N3 and H13N6
    2/425 black-tailed gulls. 1/30 H1N3 mallards 0/242 pintails.
    ----------------------------------------------------------------------
    I'm interested in expert panflu damage estimates
    my current links: http://bit.ly/hFI7H ILI-charts: http://bit.ly/CcRgT

    Comment


    • #3
      Re: mallards

      mallard genome
      ----------------

      .pdf here: http://www.nature.com/ng/journal/vao...df/ng.2657.pdf

      anas platyrhynchos is the mallard. ---10-week-old female Beijing duck ----
      We were wondering whether the Asian domestic ducks were different
      in that they can get viruses that evolved away from the index,
      which we didn't see in North American mallards.
      Well, it could just be because domestic ducks or commercial ducks
      are not popular in North America.

      A BioProject is a collection of biological data related to a single initiative, originating from a single organization or from a consortium. A BioProject record provides users a single place to find links to the diverse data types generated for that project



      ftp://ftp.ncbi.nih.gov/genbank/genom...mary_Assembly/

      I didn't find the chromosomes in fasta-format yet
      I'm not sure whether and when they will be available.

      Do I understand correctly, that they have influenza-specific genes, which evolved
      since mallards get influenza ? But that's supposed to be only some thousand years ?!?
      While DNA changes are more slowly. When we dig out the bones of a mallard that died
      >10000 years ago, might that show us whether mallards got flu 10000 years ago ?

      phylo of Eurasian ducks:
      Phylogenetic relationships, demographic history, and geographic distribution of the mtDNA haplotypes of the mallard Anas platyrhynchos were examined in three populations, Indian, Northern European, and Far Eastern. Two divergent haplotype groups, A and B, were found in the Far Eastern population, wh …

      Anas zonorhyncha in Asia, "spot billed duck"

      mitochondrial DNA was published earlier:

      paper: http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2586638/


      5 full mitochondrial mallard sequences at genbank:
      Code:
                      00000234799999901245 
                      12226297402236804053 
                      91770469426790278049 
                      79127433171163463283 
      ---Index--------ACCCTTATGTACAGACACCG 
       1 > EU009397   .TT.C............... 
       2 > EU755252   .....C....GTGAGG.... 
       3 > EU755253   G..T.CG....TG...GTTA 
       4 > FJ167857   .......CAC.......... 
       5 > HM010684   .......C.C..........
      I'm interested in expert panflu damage estimates
      my current links: http://bit.ly/hFI7H ILI-charts: http://bit.ly/CcRgT

      Comment


      • #4
        Re: mallards

        (beta-defensin and butyrophilin genes in ducks could be responsible for their better
        immunity against influenza


        Every mammalian species explored thus far has beta-defensins.
        β-defensins genes are found in the genome of both ostrich and mammalians.[8]


        gene on chromosome 6

        In this study, a novel avian beta-defensin (AvBD) was isolated from duck pancreas. The complete nucleotide sequence of the gene contained an 195 bp open reading frame encoding 64 amino acids. Homology, characterization and comparison of the gene with AvBD from other avian species confirmed that it w …

        (2009) a novel avian beta-defensin (AvBD) was isolated from duck pancreas
        64aa: MRILYLLFSVLFLVLQVSPGLSLPQRDMFLCRIGSCHFGRCPIHLVRVGS CFGFRSCCKSPWDV


        5 new beta defensins in ducks: June 2012
        198 bp, 182 bp, 201 bp, 204 bp, and 168 bp, and encoded 65, 60, 66, 67, and 55 amino acids,

        Early in infection, influenza, HSV-1 and Sendai virus modulate hBD-1 in human plasmacytoid dendritic cells, monocytes and epithelial cells, suggesting importance in innate immunity. Keywords: viral, alarmins, primary cells, antimicrobial peptides, ...


        -------from above, differences in duck species wrt. H5N1 pathogenicity--------
        yet only tufted ducks and, to a lesser degree, pochards became ill or died.
        mortality of H5N1 : mandarin ducks(~5&#37,mallards(asymptomatic)
        mortality of several H5N1 in Vietnam Muscovy ducks > 80%, 0%-100% in mallards
        high titers in muscovy brains
        ---------------------------------------------------------------
        HP H7N1 (NL03?) bad in chickens, asympt. in ducks, lung,brain,spleen
        chickens: IL-6 and IL-1β mRNA
        ducks: quicker but lower IL-6, IL-1β and iNOS
        ducks: CVI-ChNL-68.1+ , CD4+ and CD8α+ cells and apoptosis at 8 hpi
        excessive delayed cytokine inflammatory responses but inadequate cellular immune
        responses may contribute to pathogenesis in chickens
        ---------------------------------------------------------------------
        (received Sep.2010)
        at the time when our study had started, genome sequencing of the domestic duck genome
        and de novo assembly was in progress and almost completed by the Beijing Genome Institute (BGI).
        (Huang et.al



        Almost all of the varieties of domesticated ducks are descended from the Mallard
        (Anas platyrhynchos), apart from the Muscovy Duck (Cairina moschata).[1][2]
        -------------------------------------------------------------------------
        H5N1 highly pathogenic avian influenza (HPAI) viruses continue to be a threat to poultry in many regions of the world. Domestic ducks have been recognized as one of the primary factors in the spread of H5N1 HPAI. In this study we examined the pathogenicity of H5N1 HPAI viruses in different species a …

        Domestic ducks have been recognized as one of the primary factors in the spread of H5N1 HPAI.

        pathogenicity of H5N1 in Muscovy ducks (Cairina moschata) gave more severe disease
        than various breeds of Anas platyrhynchos var. domestica ducks including Pekin,
        Mallard-type, Black Runners, Rouen, and Khaki Campbell ducks.
        ----------------------------------------------------------------------------
        I'm interested in expert panflu damage estimates
        my current links: http://bit.ly/hFI7H ILI-charts: http://bit.ly/CcRgT

        Comment

        Working...
        X