Tweet
Re: South Korea: Suspected H5N1 Human Cases in Seoul
Commentary
Commentary
-
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
Comemntary
Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
<TABLE cellSpacing=0 cellPadding=0 width="100%" border=0><TBODY><TR><TD class=headtitle height=40>TAMIFLU STORY
They fell far short cure human infection </TD></TR><TR><TD style="PADDING-TOP: 0px" height=30>[경기일보 2008-5-14][Daily Round 2008-5-14] </TD></TR><TR><TD style="PADDING-RIGHT: 0px; PADDING-LEFT: 0px; PADDING-BOTTOM: 0px; COLOR: #000000; PADDING-TOP: 20px"> And Pyeongtaek in Gyeonggi Province, recently ANSUNG AI (avian influenza) outbreak, gradually growing anxiety among citizens in the metropolitan cure infection prevention, we can treat the human body 'Tamiflu (Tamiflu)' is far insufficient year. In the case of human infection are likely to have gobyeongwonseong AI (H5N1 type) as inpeulruenjain hwakjin to secure even more imperative that Tamiflu was pointed out this year.
According to the 13th race and disease management headquarters in Tokyo and currently boyuryang Tamiflu is one Anseong manjeong 2300 to Pyeongtaek including Chung, Chung Anyang 600, 500 and Yangpyeong jeongeuro Jung, a total of 19,660 people, 1,960 of the amount available Is.
In Uijeongbu, including a large number of local governments and Guri Tamiflu is the AI does not even occur at all precautions to secure itself been impossible.
In addition to Tamiflu held by the local governments do a **** about 7 to 10 patients taking one of the points that should put to that task, considering the year, AI defenses, including civil servants and police officials (Pyeongtaek 936 people ANSUNG 250 people) can only be used only if the AI spread Citizens are almost unavailable, the General said.
Moreover, the first time this year in Tokyo gobyeongwonseong AI boyuryang Tamiflu is the patient's Pyongtaek balbyeonghan bunryangin 2300 journey of more than 250 talented, which holds the largest amount of Anseong 1,000 cases, the patient can not be used outside the spread of AI measures Arrange urgent situation.
Citizens Choi (42 poseungeup Pyeongtaek) is a "chicken and ducks infected person salcheobunhanda chideo something really big was going to happen," "The local governments would have to obtain a cure precautions should be prepared for possible emergencies," he said.
In response, policy and health officials are also "AI disease occurs, the administrative headquarters reported immediately after receiving Tamiflu to assign the writing of the situation", "5000 won just over 1 Tamiflu local governments to purchase their own budget to make it in. Difficult, "he said. http://translate.google.com/translat...&hl=en&ie=UTF8</TD></TR></TBODY></TABLE>
Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
<TABLE cellSpacing=0 cellPadding=2 width="95%" align=center border=0><TBODY><TR><TD>Latest Bird Flu update and prevention measures..
In light of the widespread reports of Highly Pathogenic Bird Flu in bird populations throughout Korea, to include this week's reports of positive birds in an Aviary in East Seoul, and a Pheasant at the Seongnam Market (that was purchased earlier in the week from a farm in Gyeonggi, 26km South of Seoul), the following advice is provided to the USFK:
The Republic of Korea and USFK medical personnel are closely monitoring for Bird Flu (H5N1) infection in humans.
- Symptoms of Bird Flu (H5N1) in humans are wide-ranging and include:
- Temperature > 100.4?F (> 38?C), Sore throat, Cough, and/or Shortness of breath
- People at risk of getting H5N1 are those who have direct contact with infected birds
- Definition of "direct contact? includes: touching birds (well-appearing, sick, or dead); touching surfaces contaminated with bird feces; eating uncooked or partially cooked poultry meat or eggs; closely observing or participating in the butchering, slaughter or culling of birds
- A person is NOT at risk of H5N1 infection who simply walks by, watches or is in the same area as living birds
- No person in Korea has ever become ill from H5N1 Avian Influenza
- The ROK Soldier who had suspected Bird Flu infection DOES NOT have H5N1
- If you see a bird on a U.S. Army Garrison that is sick or dead, contact DPW
- Do not handle the birds; if you do handle a dead bird, immediately wash your hands thoroughly (15 to 20 seconds) with soap and water
- Avoidance remains the best measure to prevent contracting Bird Flu
- Do not have direct contact with wild birds or birds in aviaries, zoos, parks or on the street (such as the street markets located throughout Korea)
- Stay away from ponds or bodies of water containing ducks or other waterfowl
- Avoid poultry farms, bird markets, processing plants, slaughter houses
- Do not directly handle dead birds found USFK installations unless you are trained for this job
- Make sure your regular seasonal flu vaccination is up to date
The actual risk to humans remains low as long as they avoid direct contact with bird populations. http://www.usfk.mil/USFK/contents/viewNews.asp?id=1155
</TD></TR></TBODY></TABLE>Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
Commentary
Vietnamese H5N1 In South Korean Outbreak
Recombinomics Commentary 11:00
May 14, 2008
A government official said a highly pathogenic virus that caused bird flu in North Jeolla Province last month was confirmed to have DNA similar to that of a Vietnamese strain.
Experts predict the nation will likely suffer bird flu throughout the year if it fails to exterminate what they call the "southern-type virus."
The above comments suggest that some or all of the H5N1 in South Korea is a new clade related to H5N1 in Vietnam. This definition is somewhat unclear because there have been two distinct clades in Vietnam previously. In 2004/2005 clade 1 dominated, but more recently clade 2.3 from China (Fujian strain) has become dominated. Therefore, the genetic composition in South Korea is unclear, but several local media stories also refer to a Vietnamese (or southern strain). Clade 1 was noted for its ability to asymptomatically infect ducks and grow to high levels in the duck?s intestine, creating significant control problems.
Genetically, there is also prior evidence for exchanges between Vietnam and South Korea / Japan. The 2003 / 2004 isolates were precursors to clade 2.2 (Qinghai strain), which has become dominant in migratory birds that summer in Siberia and Mongolia. All H5N1 west of China has been clade 2.2 which was also true for South Korea and Japan in the 2006/2007 season.
However, the 2003/2004 isolates form South Korea / Japan had a novel cleavage site RERR_KKR (delected an R), which was subsequently found in northern Vietnam in early 2005. This acquisition was appended onto a clade 1 genetic background, indicating it was acquired by recombination. The change was associated with larger clusters and milder H5N1 cases.
Media reports in South Korea also suggest that the US CDC has confirmed H5N1 in patient(s) in South Korea, as had been previously seen in the soldier that was H5 positive. Korea claimed the soldier was H5N1 ?negative? because they couldn?t confirm the N1. However, they did not deny confirmation of H5, which meets the WHO definition of a confirmed case. It seems that the confirmation by the CDC is being withheld, and a Friday meeting is planed to discuss the development.
These developments may be related to recent WHO comments on sharing of research results. The withholding of this information remains hazardous to the world?s health.
http://www.recombinomics.com/News/05...a_Vietnam.htmlComment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
AI cold waves which puts all to one side in the Korean Peninsula? Human body infection dangerousness 'antenna'
<!-- 제목 -->Human body feeling torsion is high, 'southern orgin ' one case 'AI situation' new situations
<!-- 부제목 --><!--/LDCM_TITLE-->[2008-05- 31: 07: 28]
<!--LDCM_BODY-->Journalist CBS local news section movement position
Is not visible the hesitation where the AI (AI) which sweeps away the entire country will disappear not to be and this year AI viruses which occur are southern orgin the human body infection dangerousness is high, the interest is concentrated to a yes or no.
The case 'AI situations where this virus will be confirmed as the southern joint seal thing ' also are the prospect which will approach with different situation.
* '2008 AI'?Human body feeling torsion is high, 'southern orgin ' authorization?
<SCRIPT src="/nocut/takeJs/bestCutNew.js?ver=2008051423366" type=text/javascript></SCRIPT>With it where the gene base sequence of AI viruses which are diffused at Seoul to occur initially from last early in April Jeollabuk-do Kimje and Pusan etc. entire country occurs from Vietnam is become known that is similar.
The last inspection result coming out still is not but with it of the southern orgin virus where AI virus gene base sequences which once this year occur occur from Vietnam etc. the duck where the incubation period when is similar is longer the chicken is proposed under the group lung company when taking stock of the situation of etc. chain, the possibility which will be a southern orgin virus.
The southern orgin virus becomes known that the human body infection danger is higher those of different type and the authorities becomes tense.
Sent the virus sample where the agriculture and forestry sea food department occurs about from the last April Jeollabuk-do Kimje farm to the American disease management center (CDC) and requested a gene analysis and the condition on this year AI where occurs is southern orgin, the yes or no revealed that still is not confirmed.
The agriculture and forestry sea food department center as the plan which will inspect explained the epidemiology investigation result which the 16th national veterinarian scientific quarantine circle under the influence epidemiology board of inquiry executes.
* AI native phases?
The specialists AI army army occurs in the area and by with the fact that still approaches at native phase is not visible the many sides which is not stands but past with AI where occurs the aspect the somewhat is presumed as the something else, does not exclude the southern orgin one possibility where the human body infection dangerousness is high.
Fact last like the case which occurs from 2003 and 2006 domestic AI where occurs from past domestic disappeared at the spring to start in normal winter time. Until the present time when the weather of the high temperature to occur but at case last month first of this year is continued does not disappear to be being, the worry of AI native origin and human body infection is becoming larger.
* Native interception countermeasure preparation urgency
The specialists indicate in order prevents the fact that AI becomes native origin like the Vietnam etc. southern orgin nation from with Prosecuting Attorney the infection which is thorough prevent an epidemic, that the disposition reinforcement which will live is important.
Before the domestic fowls move toward the slaughterhouse from the farm, in advance must intercept AI diffusions Prosecuting Attorney infection thoroughly once the case where has become the infection comes out in years old disposition and the disease prevention which are bold.
Veteran complaint AI about 2470 the case occurs from this middle Vietnam until now about 6400 the case to occur from all 61 country and records the occurrence number of items which is most.
The case national health where AI becomes native origin seriously this, being threatened the shock which is considerable to also of course relation industry is forecast as now vice-the preventive measure preparation which is thorough is necessary is intellectual.
<SCRIPT language=javascript>viewBestCut('bestLeft')</SCRIPT>
Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
Sure, I remember the case! ''Cinque de mayo'' for WHO... something like that I read into Mr Niman site.Originally posted by niman View Post
And I remember also the media disaster caused by the Vietnam WHO attache' reportedly said that 'H5N1 hasn't mutated' and 'no immediate pandemic threat', subsequently denied by WHO headquarter with a press release.
Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
I am repost with google as it has been giving me a hard time.. Risk of human infection of the Korean Peninsula molahchin AI? Cold Snap 'touch' <!-- 제목 -->
High human gamyeomryeok 'nambanggye' if 'AI situation' new phase
<!-- 부제목 --><!--/LDCM_TITLE-->][2008-05-14 17:07:28]
<!--LDCM_BODY-->
A sweeping across the country for avian influenza (AI) has lost this year, although it showed signs of AI virus that caused a high risk of human infection of whether nambanggye attention.
If this virus is resolved in Southern gyein 'AI crisis' is another aspect of the past year.
▲'2008 AI '? high human gamyeomryeok' nambanggye '?
<SCRIPT src="/nocut/takeJs/bestCutNew.js?ver=200805150157" type=text/javascript></SCRIPT> In early April, killing the first time in Gimje, North Jeolla Province, Seoul and Busan, the AI virus is spreading nationwide, including the genetic bases of similar rank is known and it occurred in Vietnam.
Although it is not yet final test results from the AI virus genetic bases that occurred this year, ranking first in Vietnam similar to that of the virus occurred nambanggye dalboda long incubation period is talented and duck our collective set of circumstances, it seems likely nambanggye virus are being raised .
Nambanggye other types of viruses, it is higher than the risk of human infection have been known to the authorities and tension.
The Food and Agriculture, forestry and fishery farm in Gimje, North Jeolla Province last April wealth accrued virus samples to the U.S. Center for Disease Control (CDC) status, saying it sent the genetic analysis of evaluation that occurred this year, the AI is still not confirmed whether nambanggye said.
Food and Agriculture, forestry and fisheries in the 16th Division of the National Committee has conducted scientific research geomyeokwon affiliated mechanics mechanics will check to an intermediate survey said.
▲AI Agendist step?
AI was raised by area experts and places that do not yet truly Agendist step, but it seems somewhat different from the past, AI had raised estimates saying a high risk of human infection does not rule out the possibility of nambanggyeil.
In 2003 and 2006 actually occurred in the past, such as domestic trade occurs in the winter, AI had disappeared starting in spring. However, the first month of the year if the killing continues and the current hot weather is not extinguished until there is growing concern that the AI Agendist of infection with the human body.
▲▲ Agendist blocking urgent measures
Experts countries like Vietnam and nambanggye order to prevent the AI Agendist a thorough inspection and anti-epidemic infection, it's important to point out that strengthening salcheobun.
Poultry farms were infected before moving on dochukjang conduct thorough checks to prevent the spread of AI must once have been infected with a case that should be decisive salcheobungwa defenses.
So far, all 61 countries in the gobyeongwonseong 6400 AI situation has occurred and is among the highest in Vietnam, killing raised the number of 2470 cases recorded.
AI has serious health threat to indigenous people that is the case, as well as receiving a significant impact on the industry as much as expected from now will be needed to prepare a thorough safeguard intellectual.
<SCRIPT language=javascript>viewBestCut('bestLeft')</SCRIPT>
Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
[Much time to wait for a good news! IOH]
Korea Expected to Produce Bird Flu Vaccine in 3 Years
Thursday, May 15, 2008 16:58:35
Korea is expected to locally produce avian influenza vaccine in about three years to help prevent mass human infection of the bird flu virus.
The Health Ministry said Thursday the government will build a plant in Hwaseon, South Jeolla Province next year that could make enough vaccine for about 20 million patients a year.
The ministry also said it plans to increase its stockpile of anti-viral medicine.
It aims to have enough for 10 million people, more than nine times its current holdings.
In addition, the ministry plans to increase the number of quarantined sickbeds from 96 to 400 next year.
Reported by KBS WORLD Radio
-
------Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
Source: http://english.yonhapnews.co.kr/nati...06500315F.HTML
2008/05/16 20:21 KST
Bird flu virus in S. Korea a type that caused no human infection: report
혻 혻 SEOUL, May 16 (Yonhap) -- The strain of avian influenza that broke out in South Korea this year is a type that has not caused any human infections worldwide, as opposed to the kind found in Southeast Asia, the quarantine service said Friday.
혻 혻 The strain of bird flu that has swept the country for the past five weeks is different from those found in Indonesia and Vietnam, where the disease has been transmitted to humans, resulting in death, according to an intermediary report by the National Veterinary Research Quarantine Service.
혻혻 The report also said that this year's outbreak was different from the strains that occurred in 2003 and 2006 in South Korea.
혻혻 Despite culling millions of birds since early April, this year's bird flu outbreak is expected to be the worst in the country's history, with damages exceeding 100 billion won (US$95.7 million).
혻혻 The disease has been reported almost nationwide, with cities including Seoul and Busan reporting cases of the dangerous H5N1 bird flu, which can be transmitted to humans. Only the southern resort island of Jeju remains unaffected.
혻혻 The government has tallied 42 cases of highly pathogenic avian influenza, and 8-9 million birds have been destroyed so far.
혻혻 hkim@yna.co.kr
(END)Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
" The type " which is not this AI person infection instance; Something else with 2003 and 2006, (Seoul = union news) around signal journalist The AI which occurs from this year our country (AI) until now came to reveal with the fact that is a type which is not the instance which is infected to the human body. National veterinarian scientific quarantine circle Kimje which occurs in intermediate inspection resultant this AI situation early stage of 16th epidemiology board of inquiry. Chongup. Yongam. Nonsan. ' where separates from P'yongt'aek case; H5N1' Elder brother virus ' 2.3.2' Was confirmed as the channel virus, announced. Quarantine circle [ey_tta_lu_myen] AI of these types with the fact that until now China and Hong Kong, is discovered world-wide from Vietnam etc. with same channel, will occur only human body infection instance is not reported from the chicken and duck etc. Kim [sep] epidemiology investigation chairman of a committee (Kyung Book University professor) " This virus with the human body infection AI virus which is discovered from Indonesia etc. different " Explained. Only this AI virus last 2003 and 2006 was confirmed that has the channel transient difference which is discovered from two time our country. 2003 the south China area virus and are similar 2006 case China [ching] the high lake circumferential virus, namely one people ' [ching] High group ' Belonged and to the other side this time where the possible characteristic which will together flow with the north migratory bird is big the migratory bird which comes up from the Vietnam etc. south led and is propagated that was presumed. The but same virus channel difference AI usual, or does not mean a native origin is not. Kim chairman of a committee " Upper re-of the virus (usual) when failing in disease prevention, according to saying and virus quality oneself changes to " where is not; That emphasized.
Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
LOCUS DQ992839 1662 bp cRNA linear VRL 08-NOV-2006
DEFINITION Influenza A virus (A/common magpie/Hong Kong/645/2006(H5N1))
hemagglutinin (HA) gene, partial cds.
ACCESSION DQ992839
VERSION DQ992839.1 GI:116271316
KEYWORDS .
SOURCE Influenza A virus (A/common magpie/Hong Kong/645/2006(H5N1))
ORGANISM Influenza A virus (A/common magpie/Hong Kong/645/2006(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1662)
AUTHORS Smith,G.J., Fan,X.H., Wang,J., Li,K.S., Qin,K., Zhang,J.X.,
Vijaykrishna,D., Cheung,C.L., Huang,K., Rayner,J.M., Peiris,J.S.,
Chen,H., Webster,R.G. and Guan,Y.
TITLE Emergence and predominance of an H5N1 influenza variant in China
JOURNAL (er) Proc. Natl. Acad. Sci. U.S.A. 103 (45), 16936-16941 (2006) In
press
PUBMED 17075062
REFERENCE 2 (bases 1 to 1662)
AUTHORS Smith,G.J.D. and Guan,Y.
TITLE Direct Submission
JOURNAL Submitted (12-SEP-2006) State Key Laboratory of Emerging Infectious
Diseases, Department of Microbiology, The University of Hong Kong,
21 Sassoon Road, Pokfulam, Hong Kong SAR, China
FEATURES Location/Qualifiers
source 1..1662
/organism="Influenza A virus (A/common magpie/Hong
Kong/645/2006(H5N1))"
/mol_type="viral cRNA"
/strain="A/common magpie/Hong Kong/645/2006"
/serotype="H5N1"
/db_xref="taxon:407447"
/country="China"
gene 1..>1662
/gene="HA"
CDS 1..>1662
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="ABJ96772.1"
/db_xref="GI:116271317"
/translation="MEKIVILLAIVSLVKSDQICIGYHANNSTEQVDTIME KNVTVTH
AQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSY IVEKANPA
NDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACP YQGTPSFF
RNVVWLIKKNNTYPTIKRSYNNTNQEDLLILWGIHHSNDAAEQTKLYQNP TTYVSVGT
STLNQRLVPKIATRSKVNGQSGRMDFFWTILKPNDAINFESNGNFIAPEY AYKIVKKG
DSAIMKSEVEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNK LVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKE STQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAE LLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNG TYDYPQYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLW"
ORIGIN
1 atggagaaaa tagtgattct tcttgcaata gtcagccttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcgacagag caggttgaca caataatgga aaagaacgtc
121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatcta
181 gatggagtga agcctctgat tttaagagat tgtagtgtag ctggatggct cctcggaaac
241 ccaatgtgtg acgagttcat caatgtgccg gaatggtctt acatagtgga gaaggccaac
301 ccagccaatg acctctgtta cccagggaat ttcaacgact atgaagaact gaaacaccta
361 ttgagcagaa taaaccattt tgagaaaatt cagatcatcc ccaaaagttc ttggtccgat
421 catgaagcct catcaggggt gagctcagca tgtccatatc agggaacgcc ctcctttttc
481 agaaacgtgg tatggcttat caaaaagaac aatacatacc caacaataaa gagaagctac
541 aataatacca accaggaaga tcttttgatc ctgtggggga ttcatcattc taatgatgcg
601 gcagagcaga caaagctcta tcaaaaccca accacctatg tttccgttgg gacatcaaca
661 ctaaaccaga gattggtacc aaaaatagct actagatcca aagtaaacgg gcaaagtgga
721 aggatggatt tcttctggac aattttaaaa ccgaatgatg caatcaactt cgagagtaat
781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcagcaatt
841 atgaaaagtg aagtggaata tggtaactgc aacaccaagt gtcaaactcc aataggggcg
901 ataaactcta gtatgccatt ccacaacata caccctctca ccatcgggga atgccccaaa
961 tatgtgaaat caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
1021 agaagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag
1081 ggaatggtag atggttggta tgggtaccac catagcaatg agcaggggag tgggtacgct
1141 gcagacaaag aatccactca aaaggcaata gatggagtca ccaataaggt caactcgatc
1201 attgacaaaa tgaacactca gtttgaggcc gttggaaggg aatttaataa cttagaaagg
1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
1321 gctgaacttc tggttctcat ggaaaatgag agaactctag acttccatga ctcaaatgtc
1381 aagaaccttt acgacaaggt ccgactacag cttagggata atgcaaagga gctgggtaac
1441 ggttgtttcg agttctatca caaatgtgat aatgaatgta tggaaagtgt aagaaacgga
1501 acgtatgact acccgcagta ttcagaagaa gcaagattaa aaagagagga aataagtgga
1561 gtaaaattgg aatcaatagg aacttaccaa atactgtcaa tttattcaac agttgcgagt
1621 tctctagcac tggcaatcat ggtggctggt ctatctttgt ggComment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
HA travel log
gb|EF547198.1| Influenza A virus (A/mute swan/Germany/R797/06... 36.2 0.61
gb|EF110518.1| Influenza A virus (A/goosander/Switzerland/V82... 36.2 0.61
gb|DQ992852.1| Influenza A virus (A/duck/Guangxi/3857/2005(H5... 36.2 0.61
gb|DQ992839.1| Influenza A virus (A/common magpie/Hong Kong/6... 36.2 0.61Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
Code:gb|EU697217.1| Influenza A virus (A/chicken/Nigeria/228-5/200... 34.2 2.4 gb|EU697224.1| Influenza A virus (A/chicken/Nigeria/228-6/200... 34.2 2.4 gb|EU697232.1| Influenza A virus (A/chicken/Nigeria/228-10/20... 34.2 2.4 gb|EU650486.1| Influenza A virus (A/falcon/Saudi Arabia/6732-... 34.2 2.4 gb|EU623468.1| Influenza A virus (A/chicken/Egypt/9403NAMRU3-... 34.2 2.4 gb|EU623467.1| Influenza A virus (A/chicken/Egypt/9402NAMRU3-... 34.2 2.4 gb|EU574927.1| Influenza A virus (A/chicken/Israel/1055/2008(... 34.2 2.4 gb|EU532423.1| Influenza A virus (A/tiger/Shanghai/01/2005(H5... 34.2 2.4 gb|EU391537.1| Influenza A virus (A/falcon/Kuwait/1019-7/2007... 34.2 2.4 gb|EU496392.1| Influenza A virus (A/duck/Egypt/07322S-NLQP/20... 34.2 2.4 gb|EU496399.1| Influenza A virus (A/chicken/Egypt/088S-NLQP/2... 34.2 2.4 gb|EU496398.1| Influenza A virus (A/chicken/Egypt/086Q-NLQP/2... 34.2 2.4 gb|EU496397.1| Influenza A virus (A/chicken/Egypt/07701S-NLQP... 34.2 2.4 gb|EU496396.1| Influenza A virus (A/chicken/Egypt/07665S-NLQP... 34.2 2.4 gb|EU496395.1| Influenza A virus (A/chicken/Egypt/07632S-NLQP... 34.2 2.4 gb|EU496394.1| Influenza A virus (A/turkey/Egypt/07444S-NLQP/... 34.2 2.4 gb|EU496393.1| Influenza A virus (A/goose/Egypt/07364S-NLQP/2... 34.2 2.4 gb|EU496390.1| Influenza A virus (A/turkey/Egypt/07203-NLQP/2... 34.2 2.4 gb|EU496389.1| Influenza A virus (A/chicken/Egypt/07202-NLQP/... 34.2 2.4 gb|EU496388.1| Influenza A virus (A/chicken/Egypt/07201-NLQP/... 34.2 2.4 gb|EU496387.1| Influenza A virus (A/chicken/Egypt/07181-NLQP/... 34.2 2.4 gb|EU496386.1| Influenza A virus (A/chicken/Egypt/07125-NLQP/... 34.2 2.4 gb|EU496385.1| Influenza A virus (A/quail/Egypt/07120-NLQP/20... 34.2 2.4 gb|EU496384.1| Influenza A virus (A/chicken/Egypt/06612-NLQP/... 34.2 2.4 gb|EU496383.1| Influenza A virus (A/chicken/Egypt/06553-NLQP/... 34.2 2.4 gb|EU443555.1| Influenza A virus (A/Cygnus olor/Czech Republi... 34.2 2.4 gb|EU443554.1| Influenza A virus (A/turkey/Czech Republic/103... 34.2 2.4 gb|EU443553.1| Influenza A virus (A/chicken/Czech Republic/11... 34.2 2.4 gb|EU443542.1| Influenza A virus (A/Cygnus olor/Czech Republi... 34.2 2.4 gb|EU443541.1| Influenza A virus (A/Cygnus olor/Czech Republi... 34.2 2.4 gb|CY028959.1| Influenza A virus (A/chicken/Shantou/3744/2003... 34.2 2.4 gb|EU441937.1| Influenza A virus (A/pigeon/Rostov-on-Don/6/20... 34.2 2.4 gb|EU441929.1| Influenza A virus (A/muscovy duck/Rostov-on-Do... 34.2 2.4 gb|EU443629.1| Influenza A virus (A/whooper swan/Scotland/143... 34.2 2.4 gb|EU486855.1| Influenza A virus (A/starling/Rostov-on-Don/39... 34.2 2.4 gb|CY029996.1| Influenza A virus (A/chicken/Kuwait/KISR9/2007... 34.2 2.4 gb|CY029988.1| Influenza A virus (A/chicken/Kuwait/KISR8/2007... 34.2 2.4 gb|CY029980.1| Influenza A virus (A/chicken/Kuwait/KISR7/2007... 34.2 2.4 gb|CY029972.1| Influenza A virus (A/chicken/Kuwait/KISR6/2007... 34.2 2.4 gb|CY029964.1| Influenza A virus (A/chicken/Kuwait/KISR5/2007... 34.2 2.4 gb|CY029956.1| Influenza A virus (A/chicken/Kuwait/KISR3/2007... 34.2 2.4 gb|CY029948.1| Influenza A virus (A/chicken/Kuwait/KISR2/2007... 34.2 2.4 gb|EU436612.1| Influenza A virus (A/chicken/Benin/6693-16/200... 34.2 2.4 gb|EU424136.1| Influenza A virus (A/turkey/Saudi Arabia/6732-... 34.2 2.4 gb|EU424135.1| Influenza A virus (A/houbara bustard/Saudi Ara... 34.2 2.4 gb|EU401751.1| Influenza A virus (A/chicken/Rostov-on-Don/35/... 34.2 2.4 emb|AM498632.1| Influenza A virus (A/mute swan/France/06631a/... 34.2 2.4 emb|AM498631.1| Influenza A virus (A/greylag goose/France/063... 34.2 2.4 emb|AM498630.1| Influenza A virus (A/mute swan/France/06303/2... 34.2 2.4 emb|AM498629.1| Influenza A virus (A/turkey/France/06222-1.1/... 34.2 2.4 emb|AM498628.1| Influenza A virus (A/common pochard/France/06... 34.2 2.4 gb|EU401796.1| Influenza A virus (A/peacock/Mansehra-Pakistan... 34.2 2.4 gb|EU401795.1| Influenza A virus (A/goose/Lahore-Pakistan/NAR... 34.2 2.4 gb|EU401794.1| Influenza A virus (A/turkey/Islamabad-Pakistan... 34.2 2.4 gb|EF395820.1| Influenza A virus (A/mute swan/France/06299/20... 34.2 2.4 gb|EF362426.1| Influenza A virus (A/chicken/India/NIV33491/06... 34.2 2.4 gb|EF362418.1| Influenza A virus (A/chicken/India/NIV33487/06... 34.2 2.4 gb|EU373738.1| Influenza A virus (A/chicken/Togo/4106-1/2007(... 34.2 2.4 gb|EU373737.1| Influenza A virus (A/duck/Egypt/5169-1/2007(H5... 34.2 2.4 gb|EU373736.1| Influenza A virus (A/chicken/Egypt/2628-1/2007... 34.2 2.4 gb|EU373735.1| Influenza A virus (A/chicken/Egypt/452-2/2007(... 34.2 2.4 gb|EU373734.1| Influenza A virus (A/chicken/Ghana/2534/2007(H... 34.2 2.4 gb|EU371922.1| Influenza A virus (A/chicken/Egypt/9400NAMRU3-... 34.2 2.4 gb|EU371921.1| Influenza A virus (A/duck/Egypt/9399NAMRU3-CLE... 34.2 2.4 gb|EU371920.1| Influenza A virus (A/turkey/Egypt/9398NAMRU3-C... 34.2 2.4 gb|EU371919.1| Influenza A virus (A/chicken/Egypt/9397NAMRU3-... 34.2 2.4 gb|EU371918.1| Influenza A virus (A/chicken/Egypt/9396NAMRU3-... 34.2 2.4 gb|EU371917.1| Influenza A virus (A/chicken/Egypt/9392NAMRU3-... 34.2 2.4 gb|EU371916.1| Influenza A virus (A/chicken/Egypt/9391NAMRU3-... 34.2 2.4 gb|EU371915.1| Influenza A virus (A/chicken/Egypt/9390NAMRU3-... 34.2 2.4 gb|EU371913.1| Influenza A virus (A/chicken/Egypt/9388NAMRU3-... 34.2 2.4 gb|EU371912.1| Influenza A virus (A/chicken/Egypt/9387NAMRU3-... 34.2 2.4 gb|EU371911.1| Influenza A virus (A/chicken/Egypt/9386NAMRU3-... 34.2 2.4 gb|EU371910.1| Influenza A virus (A/chicken/Egypt/9385NAMRU3-... 34.2 2.4 gb|EU371909.1| Influenza A virus (A/chicken/Egypt/9384NAMRU3-... 34.2 2.4 gb|EU371908.1| Influenza A virus (A/chicken/Egypt/9383NAMRU3-... 34.2 2.4 gb|EU371907.1| Influenza A virus (A/crow/Egypt/9382NAMRU3-CLE... 34.2 2.4 gb|EU371906.1| Influenza A virus (A/chicken/Egypt/3052NAMRU3-... 34.2 2.4 gb|EU371905.1| Influenza A virus (A/chicken/Egypt/3051NAMRU3-... 34.2 2.4 gb|EU371904.1| Influenza A virus (A/quail/Egypt/3050NAMRU3-CL... 34.2 2.4 gb|EU371903.1| Influenza A virus (A/chicken/Egypt/3049NAMRU3-... 34.2 2.4 gb|EU371902.1| Influenza A virus (A/duck/Egypt/3048NAMRU3-CLE... 34.2 2.4 gb|EU371901.1| Influenza A virus (A/duck/Egypt/3047NAMRU3-CLE... 34.2 2.4 gb|EU371900.1| Influenza A virus (A/chicken/Egypt/3046NAMRU3-... 34.2 2.4 gb|EU371899.1| Influenza A virus (A/chicken/Egypt/3045NAMRU3-... 34.2 2.4 gb|EU371898.1| Influenza A virus (A/chicken/Egypt/3044NAMRU3-... 34.2 2.4 gb|EU371897.1| Influenza A virus (A/duck/Egypt/3043NAMRU3-CLE... 34.2 2.4 gb|EU402398.1| Influenza A virus (A/chicken/Rostov/22-1/2007(... 34.2 2.4 gb|EU372947.1| Influenza A virus (A/chicken/Egypt/06959-NLQP/... 34.2 2.4 gb|EU372946.1| Influenza A virus (A/chicken/Egypt/06541-NLQP/... 34.2 2.4 gb|EU372945.1| Influenza A virus (A/chicken/Egypt/06495-NLQP/... 34.2 2.4 gb|EU372944.1| Influenza A virus (A/chicken/Egypt/06459-3-NLQ... 34.2 2.4 gb|EU372943.1| Influenza A virus (A/chicken/Egypt/06207-NLQP/... 34.2 2.4 gb|EU148444.1| Influenza A virus (A/chicken/Nigeria/1071-30/2... 34.2 2.4 gb|EU148436.1| Influenza A virus (A/chicken/Nigeria/1071-29/2... 34.2 2.4 gb|EU148428.1| Influenza A virus (A/chicken/Nigeria/1071-23/2... 34.2 2.4 gb|EU148420.1| Influenza A virus (A/chicken/Nigeria/1071-22/2... 34.2 2.4 gb|EU148412.1| Influenza A virus (A/chicken/Nigeria/1071-15/2... 34.2 2.4 gb|EU148404.1| Influenza A virus (A/chicken/Nigeria/1071-10/2... 34.2 2.4 gb|EU148396.1| Influenza A virus (A/chicken/Nigeria/1071-9/20... 34.2 2.4 gb|EU148388.1| Influenza A virus (A/chicken/Nigeria/1071-7/20... 34.2 2.4 gb|EU148380.1| Influenza A virus (A/chicken/Nigeria/1071-5/20... 34.2 2.4 gb|EU148372.1| Influenza A virus (A/chicken/Nigeria/1071-4/20... 34.2 2.4 gb|EU148364.1| Influenza A virus (A/chicken/Nigeria/1071-3/20... 34.2 2.4 gb|EU148356.1| Influenza A virus (A/chicken/Nigeria/1071-1/20... 34.2 2.4 gb|EU332354.1| Influenza A virus (A/duck/Romania/TL/nov/2007(... 34.2 2.4 gb|EU332353.1| Influenza A virus (A/chicken/Romania/TL/nov/20... 34.2 2.4 gb|EU332352.1| Influenza A virus (A/cat/Romania/TL/nov/2007(H... 34.2 2.4 gb|EU233699.1| Influenza A virus (A/chicken/Korea/IS3/2006(H5... 34.2 2.4 gb|EU233675.1| Influenza A virus (A/chicken/Korea/IS/2006(H5N... 34.2 2.4 gb|EU233683.1| Influenza A virus (A/chicken/Korea/IS2/2006(H5... 34.2 2.4 gb|EU233691.1| Influenza A virus (A/chicken/Korea/CA7/2006(H5... 34.2 2.4 gb|EU233707.1| Influenza A virus (A/duck/Korea/Asan5/2006(H5N... 34.2 2.4 gb|EU233715.1| Influenza A virus (A/duck/Korea/Asan6/2006(H5N... 34.2 2.4 gb|EU233723.1| Influenza A virus (A/quail/Korea/KJ4/2006(H5N1... 34.2 2.4 gb|EU233731.1| Influenza A virus (A/environment/Korea/W149/20... 34.2 2.4 gb|EU233739.1| Influenza A virus (A/environment/Korea/W150/20... 34.2 2.4 gb|EU257631.1| Influenza A virus (A/Cygnus cygnus/Krasnodar/3... 34.2 2.4 emb|AM773724.1| Influenza A virus (A/black-necked grebe/Germa... 34.2 2.4 emb|AM749443.1| Influenza A virus (A/mute swan/Germany/R1359/... 34.2 2.4 emb|AM749442.1| Influenza A virus (A/mute swan/Germany/R1349/... 34.2 2.4 gb|EU277841.1| Influenza A virus (A/guinea fowl/Burkina Faso/... 34.2 2.4 gb|EU277833.1| Influenza A virus (A/chicken/Burkina Faso/1347... 34.2 2.4 gb|EU190482.1| Influenza A virus (A/domestic goose/Pavlodar/1... 34.2 2.4 gb|EU183331.1| Influenza A virus (A/duck/Egypt/R5/2007(H5N1))... 34.2 2.4 gb|EU183330.1| Influenza A virus (A/goose/Egypt/R4/2007(H5N1)... 34.2 2.4 gb|EU183329.1| Influenza A virus (A/chicken/Egypt/R3/2007(H5N... 34.2 2.4 gb|EU183328.1| Influenza A virus (A/chicken/Egypt/R2/2007(H5N... 34.2 2.4 gb|EU183327.1| Influenza A virus (A/chicken/Egypt/R1/2006(H5N... 34.2 2.4 gb|EU183326.1| Influenza A virus (A/chicken/Egypt/F6/2007(H5N... 34.2 2.4 gb|EU183325.1| Influenza A virus (A/duck/Egypt/F5/2006(H5N1))... 34.2 2.4 gb|EU183324.1| Influenza A virus (A/chicken/Egypt/F4/2006(H5N... 34.2 2.4 gb|EU183323.1| Influenza A virus (A/chicken/Egypt/F3/2006(H5N... 34.2 2.4 gb|EU183322.1| Influenza A virus (A/turkey/Egypt/F2/2006(H5N1... 34.2 2.4 gb|EU183321.1| Influenza A virus (A/turkey/Egypt/F1/2006(H5N1... 34.2 2.4 gb|EU146737.1| Influenza A virus (A/Indonesia/534H/2006(H5N1)... 34.2 2.4 gb|EU146745.1| Influenza A virus (A/Indonesia/538H/2006(H5N1)... 34.2 2.4 gb|EU146753.1| Influenza A virus (A/Indonesia/535H/2006(H5N1)... 34.2 2.4 gb|EU146754.1| Influenza A virus (A/Indonesia/536H/2006(H5N1)... 34.2 2.4 gb|EU146755.1| Influenza A virus (A/Indonesia/546H/2006(H5N1)... 34.2 2.4 gb|EU146785.1| Influenza A virus (A/Indonesia/560H/2006(H5N1)... 34.2 2.4 gb|EU146793.1| Influenza A virus (A/Indonesia/546bH/2006(H5N1... 34.2 2.4 gb|EU163431.1| Influenza A virus (A/chicken/Krasnodar/300/07(... 34.2 2.4 gb|EU146866.1| Influenza A virus (A/chicken/Egypt/3/2006(H5N1... 34.2 2.4 gb|EU146867.1| Influenza A virus (A/Egypt/902782/2006(H5N1)) ... 34.2 2.4 gb|EU146868.1| Influenza A virus (A/Egypt/902786/2006(H5N1)) ... 34.2 2.4 gb|EU146871.1| Influenza A virus (A/Azerbaijan/006-207/2006(H... 34.2 2.4 gb|EU146872.1| Influenza A virus (A/Azerbaijan/008-208/2006(H... 34.2 2.4 gb|EU146873.1| Influenza A virus (A/Azerbaijan/011-162/2006(H... 34.2 2.4 gb|EU146874.1| Influenza A virus (A/Azerbaijan/001-161/2006(H... 34.2 2.4 gb|EU146875.1| Influenza A virus (A/Azerbaijan/002-115/2006(H... 34.2 2.4 gb|EU146879.1| Influenza A virus (A/chicken/Egypt/1/2006(H5N1... 34.2 2.4 gb|EU146880.1| Influenza A virus (A/chicken/Egypt/2/2006(H5N1... 34.2 2.4 gb|EU146920.1| Influenza A virus (A/Nigeria/6e/07(H5N1)) segm... 34.2 2.4 emb|AM403460.2| Influenza A virus (A/mute swan/Germany/R65/06... 34.2 2.4 gb|EU124105.1| Influenza A virus (A/Duck/Madiun/BBVW1358/2005... 34.2 2.4 gb|EU124090.1| Influenza A virus (A/Turkey/Langkat/BBPVI/2005... 34.2 2.4 gb|EU124082.1| Influenza A virus (A/Chicken/Langkat/BBPV1-576... 34.2 2.4 gb|DQ887062.1| Influenza A virus (A/chicken/Jalgaon/8824/2006... 34.2 2.4 gb|DQ887061.1| Influenza A virus (A/chicken/Navapur/7972/2006... 34.2 2.4 gb|EU095033.1| Influenza A virus (A/Egypt/6251-NAMRU3/2007(H5... 34.2 2.4 gb|EU095032.1| Influenza A virus (A/Egypt/4226-NAMRU3/2007(H5... 34.2 2.4 gb|EU095031.1| Influenza A virus (A/Egypt/4082-NAMRU3/2007(H5... 34.2 2.4 gb|EU095030.1| Influenza A virus (A/Egypt/4081-NAMRU3/2007(H5... 34.2 2.4 gb|EU095029.1| Influenza A virus (A/Egypt/2751-NAMRU3/2007(H5... 34.2 2.4 gb|EU095028.1| Influenza A virus (A/Egypt/2750-NAMRU3/2007(H5... 34.2 2.4 gb|EU095027.1| Influenza A virus (A/Egypt/2631-NAMRU3/2007(H5... 34.2 2.4 gb|EU095026.1| Influenza A virus (A/Egypt/2630-NAMRU3/2007(H5... 34.2 2.4 gb|EU095025.1| Influenza A virus (A/Egypt/2629-NAMRU3/2007(H5... 34.2 2.4 gb|EU095024.1| Influenza A virus (A/Egypt/2992-NAMRU3/2006(H5... 34.2 2.4 gb|EU095023.1| Influenza A virus (A/Egypt/2991-NAMRU3/2006(H5... 34.2 2.4 gb|EU016359.1| Influenza A virus (A/common pochard/Switzerlan... 34.2 2.4 gb|EU016358.1| Influenza A virus (A/common pochard/Switzerlan... 34.2 2.4 gb|EU016357.1| Influenza A virus (A/mallard/Switzerland/V558/... 34.2 2.4 gb|EU016356.1| Influenza A virus (A/mallard/Switzerland/V537/... 34.2 2.4 gb|EU016355.1| Influenza A virus (A/common pochard/Switzerlan... 34.2 2.4 gb|EU016354.1| Influenza A virus (A/duck/Switzerland/V487/200... 34.2 2.4 gb|EU016353.1| Influenza A virus (A/duck/Switzerland/V426/200... 34.2 2.4 gb|EU016352.1| Influenza A virus (A/duck/Switzerland/V389/200... 34.2 2.4 gb|EU016351.1| Influenza A virus (A/little grebe/Switzerland/... 34.2 2.4 gb|EU016350.1| Influenza A virus (A/mute swan/Switzerland/V68... 34.2 2.4 gb|EF523696.1| Influenza A virus (A/fowl/Denmark/60296/06(H5N... 34.2 2.4 gb|EF523695.1| Influenza A virus (A/great crested grebe/Denma... 34.2 2.4 gb|EF523694.1| Influenza A virus (A/whooper swan/Denmark/7275... 34.2 2.4 gb|EF523693.1| Influenza A virus (A/whooper swan/Denmark/7224... 34.2 2.4 gb|EF523692.1| Influenza A virus (A/tufted duck/Denmark/6540/... 34.2 2.4 gb|EF523691.1| Influenza A virus (A/tufted duck/Denmark/6431/... 34.2 2.4 gb|EF523690.1| Influenza A virus (A/peregrine/Denmark/6632/06... 34.2 2.4 gb|EF523689.1| Influenza A virus (A/peacock/Denmark/60295/06(... 34.2 2.4 gb|EF523688.1| Influenza A virus (A/grey lag goose/Denmark/66... 34.2 2.4 gb|EF523687.1| Influenza A virus (A/buzzard/Denmark/6370/06(H... 34.2 2.4 gb|DQ822565.1| Influenza A virus (A/swan/Qinghai/01/2006(H5N1... 34.2 2.4 gb|DQ822564.1| Influenza A virus (A/black-headed gull/Qinghai... 34.2 2.4 gb|DQ822563.1| Influenza A virus (A/bar-headed goose/Qinghai/... 34.2 2.4 gb|EF624255.1| Influenza A virus (A/chicken/Ghana/3160-NAMRU3... 34.2 2.4 gb|EF624254.1| Influenza A virus (A/chicken/Ghana/3159-NAMRU3... 34.2 2.4 gb|EF624253.1| Influenza A virus (A/chicken/Ghana/3158-NAMRU3... 34.2 2.4 gb|EF619980.1| Influenza A virus (A/turkey/Turkey/1/2005(H5N1... 34.2 2.4 gb|EF605603.1| Influenza A virus (A/chicken/Russia_Krasnodar/... 34.2 2.4 emb|AM503005.1| Influenza A virus (A/chicken/Nigeria/OD8/2006... 34.2 2.4 emb|AM503004.1| Influenza A virus (A/chicken/Nigeria/FA4/2006... 34.2 2.4 emb|AM503003.1| Influenza A virus (A/chicken/Nigeria/AB14/200... 34.2 2.4 emb|AM503002.1| Influenza A virus (A/chicken/Nigeria/AB13/200... 34.2 2.4 emb|AM503001.1| Influenza A virus (A/chicken/Nigeria/IF10/200... 34.2 2.4 emb|AM503000.1| Influenza A virus (A/chicken/Nigeria/OD9/2006... 34.2 2.4 emb|AM502999.1| Influenza A virus (A/chicken/Nigeria/FA7/2006... 34.2 2.4 emb|AM502998.1| Influenza A virus (A/chicken/Nigeria/FA6/2006... 34.2 2.4 gb|EF547198.1| Influenza A virus (A/mute swan/Germany/R797/06... 34.2 2.4 gb|EF547197.1| Influenza A virus (A/tufted duck/Switzerland/V... 34.2 2.4 emb|AM262552.1| Influenza A virus (A/chicken/Nigeria/SO485/20... 34.2 2.4 emb|AM262551.1| Influenza A virus (A/chicken/Nigeria/SO478/20... 34.2 2.4 emb|AM262550.1| Influenza A virus (A/chicken/Nigeria/SO470/20... 34.2 2.4 emb|AM262549.1| Influenza A virus (A/chicken/Nigeria/SO461/20... 34.2 2.4 emb|AM262548.1| Influenza A virus (A/chicken/Nigeria/SO457/20... 34.2 2.4 emb|AM262545.1| Influenza A virus (A/chicken/Nigeria/SO294/20... 34.2 2.4 emb|AM262544.1| Influenza A virus (A/chicken/Nigeria/SO227/20... 34.2 2.4 gb|EF532632.1| Influenza A virus (A/duck/Gaza/760/2006(H5N1))... 34.2 2.4 gb|EF532631.1| Influenza A virus (A/chicken/Gaza/714/2006(H5N... 34.2 2.4 gb|EF532630.1| Influenza A virus (A/chicken/Gaza/713/2006(H5N... 34.2 2.4 gb|EF532629.1| Influenza A virus (A/chicken/Israel/625/2006(H... 34.2 2.4 gb|EF532628.1| Influenza A virus (A/chicken/Gaza/450/2006(H5N... 34.2 2.4 gb|EF532627.1| Influenza A virus (A/turkey/Israel/446/2006(H5... 34.2 2.4 gb|EF532626.1| Influenza A virus (A/chicken/Israel/397/2006(H... 34.2 2.4 gb|EF532625.1| Influenza A virus (A/turkey/Israel/365/2006(H5... 34.2 2.4 gb|EF532624.1| Influenza A virus (A/turkey/Israel/364/2006(H5... 34.2 2.4 gb|EF532623.1| Influenza A virus (A/turkey/Israel/345/2006(H5... 34.2 2.4 gb|EF532622.1| Influenza A virus (A/duck/Gaza/834/2006(H5N1))... 34.2 2.4 gb|EF535826.1| Influenza A virus (A/Egypt/2621-NAMRU3/2007(H5... 34.2 2.4 gb|EF535825.1| Influenza A virus (A/Egypt/2620-NAMRU3/2007(H5... 34.2 2.4 gb|EF535824.1| Influenza A virus (A/Egypt/2616-NAMRU3/2007(H5... 34.2 2.4 gb|EF535823.1| Influenza A virus (A/Egypt/2331-NAMRU3/2007(H5... 34.2 2.4 gb|EF535822.1| Influenza A virus (A/Egypt/2321-NAMRU3/2007(H5... 34.2 2.4 gb|EF535821.1| Influenza A virus (A/Egypt/2256-NAMRU3/2007(H5... 34.2 2.4 gb|EF535820.1| Influenza A virus (A/Egypt/1902-NAMRU3/2007(H5... 34.2 2.4 gb|EF535819.1| Influenza A virus (A/Egypt/1731-NAMRU3/2007(H5... 34.2 2.4 gb|EF535818.1| Influenza A virus (A/Egypt/1604-NAMRU3/2007(H5... 34.2 2.4 gb|EF535817.1| Influenza A virus (A/Egypt/1394-NAMRU3/2007(H5... 34.2 2.4 gb|EF541412.1| Influenza A virus (A/chicken/Korea/es/2003(H5N... 34.2 2.4 emb|AM400971.2| Influenza A virus (A/Hooded vulture/Burkina F... 34.2 2.4 gb|EF205160.1| Influenza A virus (A/chicken/Tula/4/05(H5N1)) ... 34.2 2.4 gb|EF205159.1| Influenza A virus (A/chicken/Krasnodar/123/06(... 34.2 2.4 gb|EF205158.1| Influenza A virus (A/turkey/Suzdalka/12/05(H5N... 34.2 2.4 gb|EF205156.1| Influenza A virus (A/goose/Suzdalka/10/05(H5N1... 34.2 2.4 gb|EF205155.1| Influenza A virus (A/chicken/Omsk/14/05(H5N1))... 34.2 2.4 gb|EF205154.1| Influenza A virus (A/chicken/Suzdalka/06/05(H5... 34.2 2.4 gb|CY021517.1| Influenza A virus (A/chicken/Ivory Coast/1787-... 34.2 2.4 emb|AM492165.1| Influenza A virus (A/stone marten/Germany/R74... 34.2 2.4 emb|AM408216.1| Influenza A virus (A/tufted duck/Germany/R124... 34.2 2.4 emb|AM408215.1| Influenza A virus (A/gull/Germany/R882/06(H5N... 34.2 2.4 emb|AM408213.1| Influenza A virus (A/common buzzard/Germany/R... 34.2 2.4 emb|AM408212.1| Influenza A virus (A/great crested grebe/Germ... 34.2 2.4 emb|AM408211.1| Influenza A virus (A/falcon/Germany/R899/06(H... 34.2 2.4 emb|AM408210.1| Influenza A virus (A/goose/Germany/R696/06(H5... 34.2 2.4 emb|AM408209.1| Influenza A virus (A/cormorant/Germany/R292/0... 34.2 2.4 emb|AM403475.1| Influenza A virus (A/stork/Germany/R1239/06(H... 34.2 2.4 emb|AM403474.1| Influenza A virus (A/Canada goose/Germany/R12... 34.2 2.4 emb|AM403473.1| Influenza A virus (A/eagle owl/Germany/R1166/... 34.2 2.4 emb|AM403472.1| Influenza A virus (A/turkey/Germany/R1077/06(... 34.2 2.4 emb|AM403471.1| Influenza A virus (A/mute swan/Germany/R854/0... 34.2 2.4 emb|AM403470.1| Influenza A virus (A/duck/Germany/R751/06(H5N... 34.2 2.4 emb|AM403469.1| Influenza A virus (A/coot/Germany/R655/06(H5N... 34.2 2.4 emb|AM403468.1| Influenza A virus (A/cat/Germany/R606/06(H5N1... 34.2 2.4 emb|AM403467.1| Influenza A virus (A/duck/Germany/R603/06(H5N... 34.2 2.4 emb|AM403466.1| Influenza A virus (A/duck/Germany/R592/06(H5N... 34.2 2.4 emb|AM403465.1| Influenza A virus (A/pochard/Germany/R348/06(... 34.2 2.4 emb|AM403464.1| Influenza A virus (A/duck/Germany/R338/06(H5N... 34.2 2.4 emb|AM403463.1| Influenza A virus (A/common buzzard/Germany/R... 34.2 2.4 emb|AM403462.1| Influenza A virus (A/whooper swan/Germany/R88... 34.2 2.4 emb|AM403461.1| Influenza A virus (A/Canada goose/Germany/R71... 34.2 2.4 gb|EF469660.1| Influenza A virus (A/chicken/Egypt/1892N3-HK49... 34.2 2.4 gb|EF469659.1| Influenza A virus (A/chicken/Egypt/1891N3-CLEV... 34.2 2.4 gb|EF469658.1| Influenza A virus (A/goose/Egypt/13009N3-SM2/2... 34.2 2.4 gb|EF469657.1| Influenza A virus (A/duck/Egypt/1888N3-SM25/20... 34.2 2.4 gb|EF469656.1| Influenza A virus (A/duck/Egypt/13010N3-CLEVB/... 34.2 2.4 gb|EF469655.1| Influenza A virus (A/duck/Egypt/12380N3-CLEVB/... 34.2 2.4 gb|EF469654.1| Influenza A virus (A/chicken/Egypt/1890N3-HK45... 34.2 2.4 gb|EF469653.1| Influenza A virus (A/chicken/Egypt/1889N3-SM26... 34.2 2.4 gb|EF469652.1| Influenza A virus (A/chicken/Egypt/12379N3-CLE... 34.2 2.4 gb|EF469651.1| Influenza A virus (A/chicken/Egypt/12378N3-CLE... 34.2 2.4 gb|EF469650.1| Influenza A virus (A/chicken/Egypt/1129N3-HK9/... 34.2 2.4 emb|AM400981.1| Influenza A virus (A/chicken/Nigeria/SO485/20... 34.2 2.4 emb|AM400980.1| Influenza A virus (A/chicken/Nigeria/SO478/20... 34.2 2.4 emb|AM400979.1| Influenza A virus (A/chicken/Nigeria/SO470/20... 34.2 2.4 emb|AM400978.1| Influenza A virus (A/chicken/Nigeria/SO461/20... 34.2 2.4 emb|AM400977.1| Influenza A virus (A/chicken/Nigeria/SO457/20... 34.2 2.4 emb|AM400976.1| Influenza A virus (A/chicken/Nigeria/SO294/20... 34.2 2.4 emb|AM400975.1| Influenza A virus (A/chicken/Nigeria/SO227/20... 34.2 2.4 emb|AM400974.1| Influenza A virus (A/chicken/Burkina Faso/01.... 34.2 2.4 emb|AM400973.1| Influenza A virus (A/chicken/Burkina Faso/13.... 34.2 2.4 emb|AM400972.1| Influenza A virus (A/Hooded vulture/Burkina F... 34.2 2.4 gb|CY021389.1| Influenza A virus (A/chicken/Sudan/2115-10/200... 34.2 2.4 gb|CY021373.1| Influenza A virus (A/chicken/Afghanistan/1573-... 34.2 2.4 gb|CY020709.1| Influenza A virus (A/turkey/Ivory Coast/4372-4... 34.2 2.4 gb|CY020701.1| Influenza A virus (A/turkey/Ivory Coast/4372-3... 34.2 2.4 gb|CY020693.1| Influenza A virus (A/turkey/Ivory Coast/4372-2... 34.2 2.4 gb|CY020677.1| Influenza A virus (A/chicken/Sudan/2115-12/200... 34.2 2.4 gb|CY020669.1| Influenza A virus (A/chicken/Sudan/2115-9/2006... 34.2 2.4 gb|CY020661.1| Influenza A virus (A/chicken/Sudan/1784-8/2006... 34.2 2.4 gb|CY020653.1| Influenza A virus (A/turkey/Egypt/2253-2/2006(... 34.2 2.4 gb|CY020645.1| Influenza A virus (A/chicken/Egypt/2253-1/2006... 34.2 2.4 gb|CY020637.1| Influenza A virus (A/chicken/Afghanistan/1573-... 34.2 2.4 gb|CY020629.1| Influenza A virus (A/chicken/Afghanistan/1573-... 34.2 2.4 gb|CY020621.1| Influenza A virus (A/chicken/Afghanistan/1573-... 34.2 2.4 gb|EF474450.1| Influenza A virus (A/chicken/Moscow/2/2007(H5N... 34.2 2.4 gb|EF441263.1| Influenza A virus (A/turkey/England/250/2007(H... 34.2 2.4 gb|EF446779.1| Influenza A virus (A/goose/Hungary/3413/2007(H... 34.2 2.4 gb|EF446771.1| Influenza A virus (A/goose/Hungary/2823/2/2007... 34.2 2.4 gb|EF441281.1| Influenza A virus (A/duck/Egypt/1301-NAMRU3/20... 34.2 2.4 gb|EF441280.1| Influenza A virus (A/chicken/Egypt/1300-NAMRU3... 34.2 2.4 gb|EF441279.1| Influenza A virus (A/chicken/Egypt/1081-NAMRU3... 34.2 2.4 gb|EF441278.1| Influenza A virus (A/chicken/Egypt/1080-NAMRU3... 34.2 2.4 gb|EF441277.1| Influenza A virus (A/chicken/Egypt/1079-NAMRU3... 34.2 2.4 gb|EF441276.1| Influenza A virus (A/chicken/Egypt/1078-NAMRU3... 34.2 2.4 gb|EF395845.1| Influenza A virus (A/swan/Austria/216/2006(H5N... 34.2 2.4 gb|EF395844.1| Influenza A virus (A/cat/Austria/649/2006(H5N1... 34.2 2.4 gb|EF208919.1| Influenza A Virus (A/chicken/Jakarta/DKI31/200... 34.2 2.4 gb|EF382359.1| Influenza A virus (A/Egypt/0636-NAMRU3/2007(H5... 34.2 2.4 gb|EF200513.1| Influenza A virus (A/Egypt/14725-NAMRU3/2006(H... 34.2 2.4 gb|EF200512.1| Influenza A virus (A/Egypt/14724-NAMRU3/2006(H... 34.2 2.4 gb|EF110519.1| Influenza A virus (A/common coot/Switzerland/V... 34.2 2.4 gb|EF110518.1| Influenza A virus (A/goosander/Switzerland/V82... 34.2 2.4 gb|EF165065.1| Influenza A virus (A/swan/Bavaria/21/2006(H5N1... 34.2 2.4 gb|EF165064.1| Influenza A virus (A/goosander/Bavaria/20/2006... 34.2 2.4 gb|EF165063.1| Influenza A virus (A/goldeneye duck/Bavaria/19... 34.2 2.4 gb|EF165062.1| Influenza A virus (A/goosander/Bavaria/18/2006... 34.2 2.4 gb|EF165061.1| Influenza A virus (A/swan/Bavaria/17/2006(H5N1... 34.2 2.4 gb|EF165060.1| Influenza A virus (A/swan/Bavaria/16/2006(H5N1... 34.2 2.4 gb|EF165059.1| Influenza A virus (A/falcon/Bavaria/15/2006(H5... 34.2 2.4 gb|EF165058.1| Influenza A virus (A/swan/Bavaria/14/2006(H5N1... 34.2 2.4 gb|EF165057.1| Influenza A virus (A/buzzard/Bavaria/13/2006(H... 34.2 2.4 gb|EF165055.1| Influenza A virus (A/common buzzard/Bavaria/11... 34.2 2.4 gb|EF165054.1| Influenza A virus (A/eagle owl/Bavaria/10/2006... 34.2 2.4 gb|EF165053.1| Influenza A virus (A/tufted duck/Bavaria/9/200... 34.2 2.4 gb|EF165052.1| Influenza A virus (A/tufted duck/Bavaria/8/200... 34.2 2.4 gb|EF165051.1| Influenza A virus (A/common pochard/Bavaria/7/... 34.2 2.4 gb|EF165050.1| Influenza A virus (A/swan/Bavaria/6/2006(H5N1)... 34.2 2.4 gb|EF165049.1| Influenza A virus (A/buzzard/Bavaria/5/2006(H5... 34.2 2.4 gb|EF165048.1| Influenza A virus (A/tufted duck/Bavaria/4/200... 34.2 2.4 dbj|AB284324.1| Influenza A virus (A/common goldeneye/Mongoli... 34.2 2.4 gb|EF090650.1| Influenza A virus (A/chicken/Burkina Faso/5346... 34.2 2.4 gb|EF090649.1| Influenza A virus (A/chicken/Burkina Faso/5346... 34.2 2.4 gb|EF090648.1| Influenza A virus (A/hooded vulture/Burkina Fa... 34.2 2.4 gb|EF090647.1| Influenza A virus (A/guinea fowl/Burkina Faso/... 34.2 2.4 gb|EF042624.1| Influenza A virus (A/teal/Egypt/14051-NAMRU3/2... 34.2 2.4 gb|EF042622.1| Influenza A virus (A/chicken/Egypt/10845-NAMRU... 34.2 2.4 gb|CY017179.1| Influenza A virus (A/guinea fowl/Nigeria/957-1... 34.2 2.4 gb|EF042621.1| Influenza A virus (A/Egypt/5614-NAMRU3/2006(H5... 34.2 2.4 gb|EF042619.1| Influenza A virus (A/Egypt/3458-NAMRU3/2006(H5... 34.2 2.4 gb|EF042620.1| Influenza A virus (A/Egypt/5494-NAMRU3/2006(H5... 34.2 2.4 gb|EF042618.1| Influenza A virus (A/Egypt/3105-NAMRU3/2006(H5... 34.2 2.4 gb|EF042617.1| Influenza A virus (A/Egypt/2947-NAMRU3/2006(H5... 34.2 2.4 gb|EF042616.1| Influenza A virus (A/Egypt/2786-NAMRU3/2006(H5... 34.2 2.4 gb|EF042615.1| Influenza A virus (A/Egypt/2783-NAMRU3/2006(H5... 34.2 2.4 gb|EF042614.1| Influenza A virus (A/Egypt/2763-NAMRU3/2006(H5... 34.2 2.4 gb|DQ997172.1| Influenza A virus (A/duck/Hubei/wq/2003(H5N1))... 34.2 2.4 gb|DQ993050.1| Influenza A virus (A/goose/Guiyang/2988/2006(H... 34.2 2.4 gb|DQ993046.1| Influenza A virus (A/duck/Guiyang/2637/2006(H5... 34.2 2.4 gb|DQ993045.1| Influenza A virus (A/goose/Guiyang/2502/2006(H... 34.2 2.4 gb|DQ993043.1| Influenza A virus (A/goose/Guiyang/2231/2006(H... 34.2 2.4 gb|DQ993042.1| Influenza A virus (A/duck/Guiyang/2159/2006(H5... 34.2 2.4 gb|DQ993041.1| Influenza A virus (A/goose/Guiyang/2071/2006(H... 34.2 2.4 gb|DQ993040.1| Influenza A virus (A/duck/Guiyang/2044/2006(H5... 34.2 2.4 gb|DQ993039.1| Influenza A virus (A/duck/Guiyang/2011/2006(H5... 34.2 2.4 gb|DQ993019.1| Influenza A virus (A/duck/Guiyang/1081/2006(H5... 34.2 2.4 gb|DQ992997.1| Influenza A virus (A/goose/Guiyang/1796/2006(H... 34.2 2.4 gb|DQ992995.1| Influenza A virus (A/goose/Guiyang/1785/2006(H... 34.2 2.4 gb|DQ992994.1| Influenza A virus (A/duck/Guiyang/1739/2006(H5... 34.2 2.4 gb|DQ992993.1| Influenza A virus (A/duck/Guiyang/1722/2006(H5... 34.2 2.4 gb|DQ992992.1| Influenza A virus (A/duck/Guiyang/1705/2006(H5... 34.2 2.4 gb|DQ992989.1| Influenza A virus (A/goose/Guiyang/1639/2006(H... 34.2 2.4 gb|DQ992985.1| Influenza A virus (A/duck/Guiyang/1558/2006(H5... 34.2 2.4 gb|DQ992975.1| Influenza A virus (A/chicken/Guiyang/1211/2006... 34.2 2.4 gb|DQ992873.1| Influenza A virus (A/goose/Guangxi/30/2006(H5N... 34.2 2.4 gb|DQ992839.1| Influenza A virus (A/common magpie/Hong Kong/6... 34.2 2.4 gb|DQ992816.1| Influenza A virus (A/goose/Yunnan/1144/2006(H5... 34.2 2.4 gb|DQ992815.1| Influenza A virus (A/goose/Yunnan/1143/2006(H5... 34.2 2.4 gb|DQ992780.1| Influenza A virus (A/Guinea fowl/Shantou/1341/... 34.2 2.4 gb|DQ992774.1| Influenza A virus (A/goose/Guiyang/1304/2006(H... 34.2 2.4 gb|DQ992773.1| Influenza A virus (A/duck/Guiyang/1260/2006(H5... 34.2 2.4 gb|DQ992770.1| Influenza A virus (A/chicken/Guiyang/1018/2006... 34.2 2.4 gb|EF061116.1| Influenza A virus (A/Egypt/12374-NAMRU3/2006(H... 34.2 2.4 gb|CY017043.1| Influenza A virus (A/swan/Slovenia/760/2006(H5... 34.2 2.4 gb|CY017035.1| Influenza A virus (A/cygnus olor/Italy/742/200... 34.2 2.4 gb|CY017027.1| Influenza A virus (A/duck/Niger/914/2006(H5N1)... 34.2 2.4 gb|DQ997276.1| Influenza A virus (A/goose/Jilin/hb/2003(H5N1)... 34.2 2.4 gb|DQ997163.1| Influenza A virus (A/duck/Hubei/wp/2003(H5N1))... 34.2 2.4 gb|CY016803.1| Influenza A virus (A/duck/Cote d'Ivoire/1787-1... 34.2 2.4 gb|CY016811.1| Influenza A virus (A/chicken/Cote d'Ivoire/178... 34.2 2.4 gb|CY016947.1| Influenza A virus (A/chicken/Nigeria/1047-34/2... 34.2 2.4 gb|CY016939.1| Influenza A virus (A/chicken/Nigeria/1047-30/2... 34.2 2.4 gb|CY016931.1| Influenza A virus (A/chicken/Nigeria/1047-62/2... 34.2 2.4 gb|CY016923.1| Influenza A virus (A/chicken/Nigeria/1047-54/2... 34.2 2.4 gb|CY016915.1| Influenza A virus (A/ostrich/Nigeria/1047-25/2... 34.2 2.4 gb|CY016907.1| Influenza A virus (A/chicken/Nigeria/1047-8/20... 34.2 2.4 gb|CY016899.1| Influenza A virus (A/duck/Egypt/2253-3/2006(H5... 34.2 2.4 gb|CY016819.1| Influenza A virus (A/cygnus olor/Croatia/1/200... 34.2 2.4 gb|CY016787.1| Influenza A virus (A/chicken/Afghanistan/1207/... 34.2 2.4 gb|CY016779.1| Influenza A virus (A/cygnus cygnus/Iran/754/20... 34.2 2.4 gb|DQ643982.1| Influenza A virus (A/cat/Germany/606/2006(H5N1... 34.2 2.4 gb|DQ464354.1| Influenza A virus (A/swan/Germany/R65/2006(H5N... 34.2 2.4 gb|CY016300.1| Influenza A virus (A/chicken/Sudan/1784-10/200... 34.2 2.4 gb|CY016292.1| Influenza A virus (A/chicken/Sudan/1784-7/2006... 34.2 2.4 gb|CY016284.1| Influenza A virus (A/chicken/Nigeria/957-20/20... 34.2 2.4 gb|CY016276.1| Influenza A virus (A/chicken/Nigeria/641/2006(... 34.2 2.4 gb|CY014477.1| Influenza A virus (A/Indonesia/CDC599N/2006(H5... 34.2 2.4 gb|CY014465.1| Influenza A virus (A/Indonesia/CDC625L/2006(H5... 34.2 2.4 gb|CY014433.1| Influenza A virus (A/Indonesia/CDC625/2006(H5N... 34.2 2.4 gb|CY014303.1| Influenza A virus (A/Indonesia/CDC599/2006(H5N... 34.2 2.4 gb|CY014296.1| Influenza A virus (A/Indonesia/CDC597/2006(H5N... 34.2 2.4 gb|CY014288.1| Influenza A virus (A/Indonesia/CDC596/2006(H5N... 34.2 2.4 gb|CY014280.1| Influenza A virus (A/Indonesia/CDC595/2006(H5N... 34.2 2.4 gb|CY014272.1| Influenza A virus (A/Indonesia/CDC594/2006(H5N... 34.2 2.4 gb|DQ914808.1| Influenza A virus (A/grebe/Tyva/Tyv06-1/2006(H... 34.2 2.4 gb|DQ861291.1| Influenza A virus (A/duck/Tuva/01/2006(H5N1)) ... 34.2 2.4 gb|DQ863503.1| Influenza A virus (A/Grebe/Tyva/Tyv06-8/2006(H... 34.2 2.4 gb|DQ864711.1| Influenza A virus (A/duck/Novosibirsk/02/05(H5... 34.2 2.4 gb|DQ864721.1| Influenza A virus (A/wild duck/Omsk/103-01/05(... 34.2 2.4 gb|DQ864720.1| Influenza A virus (A/cat/Dagestan/87/06(H5N1))... 34.2 2.4 gb|DQ864719.1| Influenza A virus (A/chicken/Volgograd/236/06(... 34.2 2.4 gb|DQ864718.1| Influenza A virus (A/chicken/Krasnodar/199/06(... 34.2 2.4 gb|DQ864717.1| Influenza A virus (A/goose/Crimea/615/05(H5N1)... 34.2 2.4 gb|DQ864716.1| Influenza A virus (A/chicken/Tambov/570-2/05(H... 34.2 2.4 gb|DQ864715.1| Influenza A virus (A/chicken/Adygea/203/06(H5N... 34.2 2.4 gb|DQ852600.1| Influenza A virus (A/grebe/Tyva/Tyv06-2/06(H5N... 34.2 2.4 gb|DQ673901.1| Influenza A virus (A/chicken/Ivory Coast/1787/... 34.2 2.4 gb|DQ862003.1| Influenza A virus (A/chicken/Sudan/1784/2006(H... 34.2 2.4 gb|DQ862002.1| Influenza A virus (A/duck/Egypt/2253-3/2006(H5... 34.2 2.4 gb|DQ862001.1| Influenza A virus (A/chicken/Egypt/2253-1/2006... 34.2 2.4 gb|DQ862000.1| Influenza A virus (A/chicken/Sudan/2115-9/2006... 34.2 2.4 gb|DQ861999.1| Influenza A virus (A/chicken/Sudan/2115-12/200... 34.2 2.4 gb|DQ837590.1| Influenza A virus (A/Turkey/Egypt/5613NAMRU3-T... 34.2 2.4 gb|DQ837589.1| Influenza A virus (A/Chicken/Egypt/5612NAMRU3-... 34.2 2.4 gb|DQ837588.1| Influenza A virus (A/Chicken/Egypt/5611NAMRU3-... 34.2 2.4 gb|DQ837587.1| Influenza A virus (A/Chicken/Egypt/5610NAMRU3-... 34.2 2.4 gb|DQ838517.1| Influenza A virus (A/chicken/Niger/2130-7/2006... 34.2 2.4 gb|DQ838516.1| Influenza A virus (A/chicken/Niger/2130-8/2006... 34.2 2.4 emb|AM262572.1| Influenza A virus (A/chicken/Nigeria/SO494/20... 34.2 2.4 emb|AM262553.1| Influenza A virus (A/chicken/Nigeria/SO493/20... 34.2 2.4 emb|AM262547.1| Influenza A virus (A/chicken/Nigeria/SO452/20... 34.2 2.4 emb|AM262546.1| Influenza A virus (A/chicken/Nigeria/SO300/20... 34.2 2.4 emb|AM262543.1| Influenza A virus (A/chicken/Nigeria/BA211/20... 34.2 2.4 emb|AM262542.1| Influenza A virus (A/chicken/Nigeria/BA210/20... 34.2 2.4 emb|AM262541.1| Influenza A virus (A/chicken/Nigeria/BA209/20... 34.2 2.4 gb|DQ666146.1| Influenza A virus (A/Djibouti/5691NAMRU3/2006(... 34.2 2.4 gb|DQ650663.1| Influenza A virus (A/chicken/Crimea/08/2005(H5... 34.2 2.4 gb|DQ650659.1| Influenza A virus (A/chicken/Crimea/04/2005(H5... 34.2 2.4 dbj|AB263752.1| Influenza A virus (A/whooper swan/Mongolia/2/... 34.2 2.4 gb|DQ643809.1| Influenza A virus (A/human/Zhejiang/16/2006(H5... 34.2 2.4 gb|DQ676840.1| Influenza A virus (A/goose/Krasnoozerka/627/20... 34.2 2.4 gb|DQ676834.1| Influenza A virus (A/chicken/Krasnodar/01/2006... 34.2 2.4 gb|DQ676830.1| Influenza A virus (A/chicken/Mahachkala/05/200... 34.2 2.4 gb|DQ659327.1| Influenza A virus (St Jude H5N1 influenza seed... 34.2 2.4 gb|DQ659326.1| Influenza A virus (St Jude H5N1 influenza seed... 34.2 2.4 gb|DQ137873.1| Influenza A virus (A/bar-headed goose/Qinghai/... 34.2 2.4 gb|DQ412997.2| Influenza A virus (A/Cygnus olor/Italy/742/200... 34.2 2.4 gb|DQ095621.2| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095618.2| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095617.2| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095616.2| Influenza A virus (A/Brown-headed Gull/Qinghai... 34.2 2.4 gb|DQ095613.2| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095612.2| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ464377.1| Influenza A virus (A/Egypt/2782-NAMRU3/2006(H5... 34.2 2.4 gb|DQ458992.1| Influenza A virus (A/mallard/Bavaria/1/2006(H5... 34.2 2.4 gb|DQ434889.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 gb|DQ449640.1| Influenza A virus (A/duck/Kurgan/08/2005(H5N1)... 34.2 2.4 gb|DQ447199.1| Influenza A virus (A/chicken/Egypt/960N3-004/2... 34.2 2.4 gb|DQ407519.1| Influenza A virus (A/turkey/Turkey/1/2005(H5N1... 34.2 2.4 gb|DQ440535.1| Influenza A virus (A/Cygnus cygnus/Iran/754/20... 34.2 2.4 gb|DQ230522.1| Influenza A virus (A/duck/Novosibirsk/56/2005(... 34.2 2.4 gb|DQ230521.1| Influenza A virus (A/grebe/Novosibirsk/29/2005... 34.2 2.4 gb|AY651368.1| Influenza A virus (A/Ck/ST/4231/2003(H5N1)) he... 34.2 2.4 gb|DQ399547.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 gb|DQ399540.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 dbj|AB233322.1| Influenza A virus (A/whooper swan/Mongolia/6/... 34.2 2.4 dbj|AB233321.1| Influenza A virus (A/whooper swan/Mongolia/4/... 34.2 2.4 dbj|AB233320.1| Influenza A virus (A/whooper swan/Mongolia/3/... 34.2 2.4 dbj|AB233319.1| Influenza A virus (A/bar-headed goose/Mongoli... 34.2 2.4 dbj|AB212649.1| Influenza A virus (A/blow fly/Kyoto/93/2004(H... 34.2 2.4 gb|DQ389158.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 gb|DQ406728.1| Influenza A virus (A/chicken/Nigeria/641/2006(... 34.2 2.4 gb|DQ363923.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 gb|DQ363918.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 gb|DQ095623.1| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095622.1| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095620.1| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095619.1| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095615.1| Influenza A virus (A/Bar-headed Goose/Qinghai/... 34.2 2.4 gb|DQ095614.1| Influenza A virus (A/Great Black-headed Gull/Q... 34.2 2.4 gb|DQ320922.1| Influenza A virus (A/Environment/Qinghai/31/20... 34.2 2.4 gb|DQ320921.1| Influenza A virus (A/migratory duck/Jiangxi/23... 34.2 2.4 gb|DQ320920.1| Influenza A virus (A/migratory duck/Jiangxi/22... 34.2 2.4 gb|DQ320919.1| Influenza A virus (A/migratory duck/Jiangxi/21... 34.2 2.4 gb|DQ365004.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 gb|DQ364996.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 gb|DQ358746.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 dbj|AB189061.1| Influenza A virus (A/crow/Osaka/102/2004(H5N1... 34.2 2.4 dbj|AB189053.1| Influenza A virus (A/crow/Kyoto/53/2004(H5N1)... 34.2 2.4 dbj|AB188824.1| Influenza A virus (A/chicken/Kyoto/3/2004(H5N... 34.2 2.4 dbj|AB188816.1| Influenza A virus (A/chicken/Oita/8/2004(H5N1... 34.2 2.4 dbj|AB166862.1| Influenza A virus (A/chicken/Yamaguchi/7/2004... 34.2 2.4 gb|DQ100557.2| Influenza A virus (A/great black-headed gull/Q... 34.2 2.4 gb|DQ100556.1| Influenza A virus (A/black-headed gull/Qinghai... 34.2 2.4 gb|DQ100555.1| Influenza A virus (A/black-headed goose/Qingha... 34.2 2.4 gb|AY609312.1| Influenza A virus (A/chicken/Guangdong/174/04(... 34.2 2.4 gb|DQ343502.1| Influenza A virus (A/Cygnus olor/Astrakhan/Ast... 34.2 2.4 gb|AY676036.1| Influenza A virus (A/duck/Korea/ESD1/03(H5N1))... 34.2 2.4 gb|AY676035.1| Influenza A virus (A/chicken/Korea/ES/03(H5N1)... 34.2 2.4 gb|DQ323672.1| Influenza A virus (A/chicken/Kurgan/3/2005(H5N... 34.2 2.4
Comment
-
Re: South Korea: Suspected H5N1 Human Cases in Seoul
gb|EU016359.1| Influenza A virus (A/common pochard/Switzerlan... 32.2 9.5
gb|EU016357.1| Influenza A virus (A/mallard/Switzerland/V558/... 32.2 9.5
gb|EU016352.1| Influenza A virus (A/duck/Switzerland/V389/200... 32.2 9.5
gb|DQ992857.1| Influenza A virus (A/duck/Guangxi/4318/2005(H5... 32.2 9.5
gb|DQ992839.1| Influenza A virus (A/common magpie/Hong Kong/6... 32.2 9.5
gb|DQ997318.1| Influenza A virus (A/chicken/Jilin/hj/2003(H5N... 32.2 9.5
gb|DQ356886.1| Influenza A virus (A/chicken/Anhui/M(H5N1)) he... 32.2 9.5
gb|AF102679.1| Influenza A virus (A/Hong Kong/503/97(H5N1)) h... 32.2 9.5
gb|AF102678.1| Influenza A virus (A/Hong Kong/542/97(H5N1)) h... 32.2 9.5
gb|AF102677.1| Influenza A virus (A/Hong Kong/491/97(H5N1)) h... 32.2 9.5
gb|AF082035.1| Influenza A virus (A/Chicken/Hong Kong/786/97 ... 32.2 9.5
gb|AF082034.1| Influenza A virus (A/Chicken/Hong Kong/728/97 ... 32.2 9.5
gb|AF046099.1| Influenza A virus (A/Chicken/Hong Kong/728/97 ... 32.2 9.5
gb|AF098542.1|AF098542 Influenza A virus (A/Chicken/Hong Kong... 32.2 9.5
gb|AF098541.1|AF098541 Influenza A virus (A/Chicken/Hong Kong... 32.2 9.5Comment
Comment