medpedia.com FluTrackers

Tracking Infectious Diseases since 2006

FluTrackers.com Inc. is a 501(c)(3) charity

Official PayPal Seal
H1N1 Swine Flu Information Información Gripe H1N1 Information Grippe H1N1 Influenza H1N1 Informazioni FluTrackers Latest Posts

www www.flutrackers.com



Go Back   FluTrackers > ** FLUTRACKERS SWINE FLU - A /H1N1 NEWS FORUM** > South America > Brazil

Brazil Announcements, strategies & resources for dealing with a pandemic

Reply
 
Thread Tools Search this Thread Display Modes
  #1  
Old June 16th, 2009, 11:50 AM
tropicalgirl's Avatar
tropicalgirl tropicalgirl is offline
Senior User
 
Join Date: May 2009
Location: São Paulo, Brazil
Posts: 134
Default A/São Paulo/H1N1 - mutation on Hemaglutinina

Warning - google translation

Tue, 16/06/09 - 11h20
São Paulo isolates of influenza A virus H1N1

Genetic sequencing revealed that proteins of the virus is not the same standard found in California, genetic characterization will contribute to production of vaccine

The State of São Paulo has isolated and sequenced, so pioneer in Brazil, the influenza virus A H1N1, popularly known as swine flu. The study was conducted by Instituto Adolfo Lutz, organ of the Secretary of Health, from the material collected in the first case of Sao Paulo disease, confirmed in April.

Following the guidelines of the World Health Organization (WHO), the Secretary named the new strain of Influenza A / Paulo/H1N1 are. The genetic sequencing revealed a mutation in the hemagglutinin protein, responsible for the ability to infect the virus, which no longer has the same pattern of the virus in California (USA), first isolated in the current pandemic.

The genetic characterization of the virus is crucial to whether the standard is maintained or have differed from those found in other regions of the world.

"This work is extremely important to monitor the behavior of the virus, which will contribute to the production of the vaccine and to assess the response to anti-viral," says Martha Solomon, director of the Institute Adolfo Lutz.

So far were recorded in the 27 cases of influenza A H1N1. 21 other cases are considered suspect and are being investigated. No death by disease in São Paulo.

Eighteen hospitals across the state serve as reference for treatment of suspected cases of the new flu. These units have beds for isolation and are in readiness to identify any case, report the fact immediately to the Center of Epidemiological Surveillance (CVE) and the Secretariat to take samples of nasal and throat secretions of patients.

The virological examinations are being conducted at the Instituto Adolfo Lutz, one of three references to the national identification of influenza that meets standards of biosecurity needed for the manipulation of viruses.

Department of Health

Source: http://www.saopaulo.sp.gov.br/spnoti....php?id=202024

_______________________
Original post in portuguese:

Ter, 16/06/09 - 11h20
São Paulo isola vírus da gripe A H1N1

Seqüenciamento genético revela que proteína do vírus não é do mesmo padrão do encontrado na Califórnia; caracterização genética contribuirá para produção de vacina

O Estado de São Paulo conseguiu isolar e seqüenciar, de forma pioneira no Brasil, o vírus da gripe A H1N1, popularmente conhecida como gripe suína. O trabalho foi realizado pelo Instituto Adolfo Lutz, órgão da Secretaria de Estado da Saúde, a partir do material colhido do primeiro caso paulista da doença, confirmado em abril.

Seguindo as diretrizes da Organização Mundial de Saúde (OMS), a Secretaria denominou a nova estirpe de Influenza A/São Paulo/H1N1. O seqüenciamento genético revelou uma mutação na proteína Hemaglutinina, responsável pela capacidade de infectar do vírus, que já não tem o mesmo padrão do vírus da Califórnia (EUA), o primeiro isolado na atual pandemia.

A caracterização genética do vírus é fundamental para saber se o padrão se mantém ou já diferenciou dos encontrados em outras regiões do mundo.

"Esse trabalho é de extrema importância para monitorar o comportamento do vírus, o que irá contribuir para a produção da vacina e para avaliar a resposta aos medicamentos anti-virais", afirma Marta Salomão, diretora do Instituto Adolfo Lutz.

Até o momento foram registrados no Estado 27 casos de gripe A H1N1. Outros 21 casos são considerados suspeitos e estão sendo investigados. Não há nenhum óbito pela doença em São Paulo.

Dezoito hospitais em todo o Estado funcionam como referência para atendimento de casos suspeitos da nova gripe. Essas unidades possuem leitos de isolamento e ficam de prontidão para identificar qualquer caso, comunicar o fato imediatamente ao Centro de Vigilância Epidemiológica (CVE) da Secretaria e colher amostras de secreções nasais e da garganta dos pacientes.

Os exames virológicos estão sendo realizados no Instituto Adolfo Lutz, uma das três referências nacionais para a identificação da influenza que atende às normas de biossegurança necessária para a manipulação de vírus.

Da Secretaria da Saúde

Fonte: http://www.saopaulo.sp.gov.br/spnoti....php?id=202024
Reply With Quote
  #2  
Old June 16th, 2009, 01:45 PM
tropicalgirl's Avatar
tropicalgirl tropicalgirl is offline
Senior User
 
Join Date: May 2009
Location: São Paulo, Brazil
Posts: 134
Default Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

More information about it:

Warning - automatic translation -


Tuesday, June 16, 2009, 13:17 | Online

Adolfo Lutz isolated variant of the H1N1 virus that arrived in Brazil

The sequencing will contribute to the production of influenza vaccine and evaluation of response to antiviral

Ana Conception of the State Agency

Adolfo Lutz isolated variant of the H1N1 virus that arrived in Brazil
SÃO PAULO - The Institute Adolfo Lutz, Department of Health of São Paulo, announced the isolation of a subtype of H1N1, known as swine flu virus, an important step for the Brazilian production of vaccine against the disease. The isolation was done by the team of virology Terezinha Maria de Paiva.





The isolation of the virus made possible the genetic sequencing of the Brazilian strain of the virus, which was called A / Paulo/1454/H1N1 are. According to notes of the Institute, the genetic characterization is essential in the investigation of molecular epidemiology of the virus, whether the standard is maintained viral or has differed from those found in other regions of the world.



According to the researchers, although this virus has some differences with the first copy of strain A (H1N1) idenficado in the United States, called the California virus, it would still be vulnerable to a vaccine created to combat it.



The sequencing will also contribute to the production of influenza vaccine and evaluation of the response of patients to antiviral.



In Chicago, the first case of human infection caused by the new strain of virus was identified in a man of 26 years who presented the symptoms of flu to return from a trip to Mexico.



The patient was hospitalized on April 24 at the Institute of Infectious Diseases Emilio Ribas and recovered it. Respiratory secretion sample of this patient was investigated by researchers of the Adolfo Lutz, who later isolated the virus. As this virus was imported from Mexico, is not yet possible to say whether he will be the predominant form of the disease in Brazil.



In bulletin issued on the afternoon of Monday, 15, the Ministry of Health confirmed 74 cases in the country, most concentrated in the states of São Paulo, Santa Catarina and Rio de Janeiro.



The total of confirmed cases of the disease in the world is at least 37 thousand, according to World Health Organization (WHO) and international agencies. Since it emerged in Mexico in April this year the disease killed at least 163 people, mostly in North America.



(with Alexandre Gonçalves, O Estado de S. Paulo)

Source: http://www.estadao.com.br/noticias/vidae, adolfo-lutz-iso-Brazilian-variant-virus-of-the-flu-fever, 388181.0. Htm


__________
Original post:


terça-feira, 16 de junho de 2009, 13:17 | Online

Adolfo Lutz isola variante do vírus H1N1 que chegou ao Brasil

O sequenciamento vai contribuir para a produção da vacina contra a gripe e avaliação da resposta aos antivirais

Ana Conceição, da Agência Estado

Adolfo Lutz isola variante do vírus H1N1 que chegou ao Brasil
SÃO PAULO - O Instituto Adolfo Lutz, da Secretaria de Saúde de São Paulo, anunciou o isolamento de um subtipo do H1N1, conhecido por vírus da gripe suína, uma etapa importante para a produção da vacina brasileira contra a doença. O isolamento foi feito pela equipe da virologista Terezinha Maria de Paiva.





O isolamento do vírus tornou possível o sequenciamento genético da estirpe brasileira do vírus, que foi batizado de A/São Paulo/1454/H1N1. De acordo com nota do Instituto, a caracterização genética é fundamental na investigação da epidemiologia molecular do vírus, para saber se o padrão viral se mantém ou já se diferenciou dos encontrados em outras regiões do mundo.



De acordo com os pesquisadores, embora esse vírus tenha algumas diferenças em relação ao primeiro exemplar da cepa A(H1N1) idenficado nos Estados Unidos, o chamado vírus Califórnia, ele ainda assim seria vulnerável a uma vacina criada para combatê-lo.



O sequenciamento também irá contribuir para a produção da vacina contra a gripe e avaliação da resposta dos doentes aos antivirais.



Em São Paulo, o primeiro caso de infecção humana causada pela nova estirpe do vírus foi identificado em um homem de 26 anos que apresentou os sintomas da gripe ao retornar de uma viagem ao México.



O paciente foi internado em 24 de abril no Instituto de Infectologia Emílio Ribas e recuperou-se. Amostra de secreção respiratória deste paciente foi investigada pelos pesquisadores do Adolfo Lutz, que depois isolaram o vírus. Como esse vírus veio importado do México, ainda não é possível dizer se ele será a forma predominante da doença no Brasil.



Em boletim emitido na tarde de segunda-feira, 15, o Ministério da Saúde do Brasil confirmava 74 casos no País, a maioria concentrada nos Estados de São Paulo, Santa Catarina e Rio de Janeiro.



O total de casos confirmados da doença no mundo é de pelo menos 37 mil, de acordo com a Organização Mundial da Saúde (OMS) e agências internacionais. Desde que surgiu no México, em abril deste ano, a doença matou pelo menos 163 pessoas, a maioria na América do Norte.



(com Alexandre Gonçalves, de O Estado de S. Paulo)

Fonte: http://www.estadao.com.br/noticias/v...a,388181,0.htm
Reply With Quote
  #3  
Old June 16th, 2009, 02:23 PM
Chuck Chuck is offline
Moderator
 
Join Date: Jun 2009
Location: Missouri
Posts: 594
Default Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

http://www.google.com/hostednews/afp...NAik9vzooON1FA

Brazil finds new strain of H1N1 virus

25 minutes ago

SAO PAULO (AFP) — Brazilian scientists have identified a new strain of the H1N1 virus after examining samples from a patient in Sao Paulo, their institute said Tuesday.

The variant has been called A/Sao Paulo/1454/H1N1 by the Adolfo Lutz Bacteriological Institute, which compared it with samples of the A(H1N1) swine flu from California.

The genetic sequence of the new sub-type of the H1N1 virus was isolated by a virology team lead by one of its researchers, Terezinha Maria de Paiva, the institute said in a statement.

The mutation comprised of alterations in the Hemagglutinin protein which allows the virus to infect new hosts, it said.

It was not yet known whether the new strain was more aggressive than the current A(H1N1) virus which has been declared pandemic by the World Health Organization.

The genetic make-up of the H1N1 virus and its subvariants are important for scientists.

Pharmaceutical companies are working to mass produce a vaccine against the current A(H1N1) flu.

There are fears though that it could mutate into a deadly strain, much in the same way as the 1918 Spanish flu -- also an A(H1N1) virus type -- did when it killed tens of millions around the planet.

According to the WHO, 36,000 people in 76 countries have been infected with the H1N1 virus, causing 163 deaths
Reply With Quote
  #4  
Old June 16th, 2009, 03:45 PM
gsgs's Avatar
gsgs gsgs is offline
Registered User
 
Join Date: Feb 2006
Location: germany
Posts: 8,620
Default Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

just C1408T.
Could be the Mexico-City substrain formerly called Korea-strain

segments 5 and/or 6 are needed
__________________
I'm interested in expert panflu damage estimates
my current links: http://bit.ly/hFI7H ILI-charts: http://bit.ly/CcRgT
Reply With Quote
  #5  
Old June 16th, 2009, 03:47 PM
Auburn Boy Auburn Boy is offline
Registered User
 
Join Date: Feb 2006
Posts: 42
Default Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

Quote:
Originally Posted by gsgs View Post
just C1408T.
Could be the Mexico-City substrain formerly called Korea-strain

segments 5 and/or 6 are needed
From PFI:

Quote:
Originally Posted by AtomicVirus
here it is again:
http://www.google.com/hostednews/afp...NAik9vzooON1FA
Brazil finds new strain of H1N1 virus
SAO PAULO (AFP) — Brazilian scientists have identified a new strain of the H1N1 virus after examining samples from a patient in Sao Paulo, their institute said Tuesday.
The variant has been called A/Sao Paulo/1454/H1N1 by the Adolfo Lutz Bacteriological Institute, which compared it with samples of the A(H1N1) swine flu from California.
The genetic sequence of the new sub-type of the H1N1 virus was isolated by a virology team lead by one of its researchers, Terezinha Maria de Paiva, the institute said in a statement.
The mutation comprised of alterations in the Hemagglutinin protein which allows the virus to infect new hosts, it said.
It was not yet known whether the new strain was more aggressive than the current A(H1N1) virus which has been declared pandemic by the World Health Organization.
The genetic make-up of the H1N1 virus and its subvariants are important for scientists.
Pharmaceutical companies are working to mass produce a vaccine against the current A(H1N1) flu.
There are fears though that it could mutate into a deadly strain, much in the same way as the 1918 Spanish flu -- also an A(H1N1) virus type -- did when it killed tens of millions around the planet.
Brazil submitted the HA gene to NCBI on June 8, and the MP Gene on June 9.
HA = GQ247724
MP = GQ250156
I bet there are a few folks on "SEQUENCES" who will eat this release up!
Reply With Quote
  #6  
Old June 16th, 2009, 03:47 PM
ironorehopper's Avatar
ironorehopper ironorehopper is offline
Membro del Comitato Consultivo, Editore e Direttore del Forum Italiano di FluTrackers
 
Join Date: Dec 2007
Location: PADUA
Posts: 12,355
Default Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

GenBank: GQ247724.1
Influenza A virus (A/Sao Paulo/1454/2009(H1N1)) segment 4 hemagglutin (HA) gene, complete cds




LOCUS GQ247724 1701 bp cRNA linear VRL 08-JUN-2009
DEFINITION Influenza A virus (A/Sao Paulo/1454/2009(H1N1)) segment 4
hemagglutin (HA) gene, complete cds.
ACCESSION GQ247724
VERSION GQ247724.1 GI:239504533
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Sao Paulo/1454/2009(H1N1))
ORGANISM Influenza A virus (A/Sao Paulo/1454/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
AUTHORS de Paiva,T.M., Santos,C.S., Silva,D.B., Correa,K.O., Ishida,M.A.,
Benega,M.A. and Sacchi,C.
TITLE Human infection with novel swine H1N1 influenza virus in Sao Paulo,
Brazil
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1701)
AUTHORS de Paiva,T.M., Santos,C.S., Silva,D.B., Correa,K.O., Ishida,M.A.,
Benega,M.A. and Sacchi,C.
TITLE Direct Submission
JOURNAL Submitted (05-JUN-2009) Respiratory Virus Section, Adolfo Lutz
Institute, Av. Dr. Arnaldo 355, Sao Paulo, SP 01246/902, Brazil
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus (A/Sao
Paulo/1454/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Sao Paulo/1454/2009"
/serotype="H1N1"
/isolation_source="nasal swab"
/host="Homo sapiens; gender M; age 26"
/db_xref="taxon:650343"
/segment="4"
/country="Brazil"
/collection_date="29-Apr-2009"
/note="lineage: swl
first MDCK cell passage"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/codon_start=1
/product="hemagglutin"
/protein_id="ACR78585.1"
/db_xref="GI:239504534"
/translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWS YIVETSSS
DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAA CPHAGAKS
FYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQ NADAYVFV
GSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVP RYAFAMER
NAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKS TKLRLATG
LRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKS TQNAIDEI
TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAEL LVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT YDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNG SLQCRICI"
ORIGIN
1 atgaaggcaa tactagtagt tctgctatat acatttgcaa ccgcaaatgc agacacatta
61 tgtataggtt atcatgcgaa caattcaaca gacactgtag acacagtact agaaaagaat
121 gtaacagtaa cacactctgt taaccttcta gaagacaagc ataacgggaa actatgcaaa
181 ctaagagggg tagccccatt gcatttgggt aaatgtaaca ttgctggctg gatcctggga
241 aatccagagt gtgaatcact ctccacagca agctcatggt cctacattgt ggaaacatct
301 agttcagaca atggaacgtg ttacccagga gatttcatcg attatgagga gctaagagag
361 caattgagct cagtgtcatc atttgaaagg tttgagatat tccccaagac aagttcatgg
421 cccaatcatg actcgaacaa aggtgtaacg gcagcatgtc ctcatgctgg agcaaaaagc
481 ttctacaaaa atttaatatg gctagttaaa aaaggaaatt catacccaaa gctcagcaaa
541 tcctacatta atgataaagg gaaagaagtc ctcgtgctat ggggcattca ccatccatct
601 actagtgctg accaacaaag tctctatcag aatgcagatg catatgtttt tgtggggtca
661 tcaagataca gcaagaagtt caagccggaa atagcaataa gacccaaagt gagggatcaa
721 gaagggagaa tgaactatta ctggacacta gtagagccgg gagacaaaat aacattcgaa
781 gcaactggaa atctagtggt accgagatat gcattcgcaa tggaaagaaa tgctggatct
841 ggtattatca tttcagatac accagtccac gattgcaata caacttgtca gacacccaag
901 ggtgctataa acaccagcct cccatttcag aatatacatc cgatcacaat tggaaaatgt
961 ccaaaatatg taaaaagcac aaaattgaga ctggccacag gattgaggaa tgtcccgtct
1021 attcaatcta gaggcctatt tggggccatt gccggtttca ttgaaggggg gtggacaggg
1081 atggtagatg gatggtacgg ttatcaccat caaaatgagc aggggtcagg atatgcagcc
1141 gacctgaaga gcacacagaa tgccattgac gagattacta acaaagtaaa ttctgttatt
1201 gaaaagatga atacacagtt cacagcagta ggtaaagagt tcaaccacct ggaaaaaaga
1261 atagagaatt taaataaaaa agttgatgat ggtttcctgg acatttggac ttacaatgcc
1321 gaactgttgg ttctattgga aaatgaaaga actttggact accacgattc aaatgtgaag
1381 aacttatatg aaaaggtaag aagccagtta aaaaacaatg ccaaggaaat tggaaacggc
1441 tgctttgaat tttaccacaa atgcgataac acgtgcatgg aaagtgtcaa aaatgggact
1501 tatgactacc caaaatactc agaggaagca aaattaaaca gagaagaaat agatggggta
1561 aagctggaat caacaaggat ttaccagatt ttggcgatct attcaactgt cgccagttca
1621 ttggtactgg tagtctccct gggggcaatc agtttctgga tgtgctctaa tgggtctcta
1681 cagtgtagaa tatgtattta a

-
http://www.ncbi.nlm.nih.gov/nuccore/...uence_RVDocSum
-----
//
__________________
GIMI69 (IRONOREHOPPER)
--

People come and go, but the creative force of great historical events, as well as important ideas and actions remain. (Aleksandr Romanovic Lurija, 1976)
--
A TIME'S MEMORY (Blog)
ATTRAVERSO QUESTI GIORNI (Blog)
tracciatore_traccia@libero.it
Reply With Quote
  #7  
Old June 16th, 2009, 04:39 PM
tropicalgirl's Avatar
tropicalgirl tropicalgirl is offline
Senior User
 
Join Date: May 2009
Location: São Paulo, Brazil
Posts: 134
Default Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

*WARNING GOOGLE TRANSLATION*

TECHNICAL NOTE

Human cases of respiratory infection caused by a new type of influenza virus A, subtype H1N1 were of porcine origin reported by the Center for Disease Control and Prevention from 21 April 2009. So far, the disease was detected in 73 countries, with 25.3 thousand confirmed cases, 139 of them fatal. The new virus presents a unique combination of gene segments that in the past had been reported between the influenza virus from swine or human origin.

In São Paulo, the first case of human infection caused by the new strain was identified in a man of 26 years who presented the symptoms of flu to return from a trip to Mexico. The patient was hospitalized on April 24 at the Institute of Infectious Diseases Emilio Ribas and is fully recovered.

Respiratory secretion sample of this patient was subjected to molecular rt PCR methodology (§ reaà the polymerase chain in real time) with probe specific for the new subtype H1N1 by the team of molecular biologist Claudio Sacchi, and the result for the new viral subtype .

Following the research the team of virology Terezinha Maria de Paiva, the Institute Adolfo Lutz, São Paulo, isolated at the end of April that the new strain is now known as A / Paulo/1454/H1N1 are following the rules of the World Health Organization . The virus isolation was performed in cell culture using the MDCK cells successfully in the first passage. In section electron microscopy of the Adolfo Lutz, Marli Ueda and Jonas Kisielius identified several virus particles from the infected culture. also the first observation.

The isolation of the virus provided the sequence of the genetic material of the Brazilian strain, experiments being performed by Dr. Cecília Luiza Simões dos Santos of the Instituto Adolfo Lutz.

The initial molecular characterization of strain A / Paulo/1454/H1N1 are involved the determination of complete sequences of two gene segments, segment 4, which encodes a protein Hemaglutina (HA) responsible for viral infectivity and for which antibodies are produced protectors, and segment 7, which encodes the matrix protein (MP) M1 and M2. The complete sequences of the genes HA and HB, the first determined for strains isolated in Brazil, are available in GenBank, a database that U.S. shared sequences obtained worldwide, which can be consulted by their respective numbers of access: GQ247724 (HA gene) and GQ250156 (MP gene). Molecular analysis indicated that while the virus segment 7 of A / Paulo/1454/H1N1 are shown to be completely conserved when compared to the reference strain A/Califórnia/04/H1N1, segment 4 showed a discrete number of nucleotide changes and of amino acids, with similar rates of around 99, 7% and 99.5% respectively. Detection of amantadine-resistance marker, comprising the amino acid asparagine (N) located at position 31 (N31) of the M2 protein in strain A / San Paulo/1454/H1N1, corroborates the literature that point be the new virus resistant to this class of antiviral compounds.

The genetic characterization is essential in the investigation of molecular epidemiology of the virus to see if the viral pattern remains or has differed from those found in other world regions, contributing to the production of vaccine and evaluation of response to antivirals.

Source: http://www.ial.sp.gov.br/

________________________________
original in portuguese:

NOTA TÉCNICA

Casos humanos de infecção respiratória causada por um novo tipo de vírus da Influenza A, subtipo H1N1 de origem suína foram relatados pelo Center for Disease Control and Prevention a partir de 21 de Abril de 2009. Até o momento,a doença foi detectada em 73 países, com 25,3 mil casos confirmados,dos quais 139 fatais. O novo vírus apresenta uma combinação única de segmentos gênicos que nã o havia sido anteriormente relatada entre vírus da influenza de origem suína ou humana.

Em São Paulo, o primeiro caso de infecção humana causada pela nova estirpe foi identificado em um homem de 26 anos que apresentou os sintomas da gripe ao retornar de uma viagem ao México. O paciente foi internado em 24 de abril no Instituto de Infectologia Emílio Ribas e recuperou-se plenamente.

Amostra de secreção respiratória deste paciente foi submetida à metodologia molecular rt PCR (reação da polimerase em cadeia em tempo real) com sonda específica para o novo subtipo H1N1 pela equipe do biólogo molecular Claudio Sacchi; sendo o resultado positivo para o novo subtipo viral.

Na sequência da investigação a equipe da virologista Terezinha Maria de Paiva, do Instituto Adolfo Lutz, em São Paulo isolou no final de abril a nova estirpe que passou a ser denominada A/São Paulo/1454/H1N1 segundo as normas da Organização Mundial da Saúde. O isolamento viral foi efetuado em cultivo celular utilizando-se as células MDCK com sucesso já na primeira passagem. Na seção de microscopia eletrônica do Adolfo Lutz, Marli Ueda e Jonas Kisielius identificaram várias partículas do vírus a partir da cultura infectada. também na primeira observação.

O isolamento do vírus propiciou o sequenciamento do material genético da estirpe brasileira, experimentos que estão sendo efetuados pela Dra. Cecília Luiza Simões dos Santos do Instituto Adolfo Lutz.

A caracterização molecular inicial da estirpe A/São Paulo/1454/H1N1 envolveu a determinação das sequências nucleotídicas completas de dois segmentos gênicos, o segmento 4, que codifica a proteína Hemaglutina (HA)responsável pela infectividade viral e para a qual são produzidos os anticorpos protetores; e o segmento 7, que codifica as proteínas da matriz (MP) M1 e M2. As sequências completas dos genes HA e MP, as primeiras determinadas para estirpes isoladas no Brasil, estão disponíveis no GenBank, banco de dados americano que compartilha sequências nucleotídicas obtidas mundialmente, que podem ser consultadas por seus respectivos números de acesso: GQ247724 (gene HA) e GQ250156 (gene MP). A análise molecular indicou que, enquanto o segmento 7 do vírus A/São Paulo/1454/H1N1 mostrou-se completamente conservado quando comparado ao da estirpe referencia A/Califórnia/04/H1N1, o segmento 4 apresentou um numero discreto de alterações nucleotídicas e de aminoácidos, com taxas de similaridade em torno de 99, 7 % e 99,5%, respectivamente. A detecção do marcador de resistência a amantadina, constituído pelo aminoácido asparagina (N) localizado na posição 31 (N31) da proteína M2, na estirpe A/São Paulo/1454/H1N1, corrobora os dados da literatura que apontam ser o novo vírus resistente a esta classe de compostos antivirais.

A caracterização genética é fundamental na investigação da epidemiologia molecular do vírus para saber se o padrão viral se mantém ou já se diferenciou dos encontrados em outras regiões do mundo, contribuir para a produção de vacina e avaliação de resposta aos antivirais.

Fonte: http://www.ial.sp.gov.br/
Reply With Quote
  #8  
Old June 16th, 2009, 04:47 PM
gsgs's Avatar
gsgs gsgs is offline
Registered User
 
Join Date: Feb 2006
Location: germany
Posts: 8,620
Default Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

CA/04 should not reasonably considered the reference strain
(it has 2 mutations already)
although used in the US-vaccine

then comes the 3rd difference from the Mex-strain, but in HA2,
so antigenically irrelevant
__________________
I'm interested in expert panflu damage estimates
my current links: http://bit.ly/hFI7H ILI-charts: http://bit.ly/CcRgT
Reply With Quote
Reply


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is On

Disclaimer:

The reader is responsible for discerning the validity, factuality or implications of information posted here, be it fictional or based on real events. Moderators on this forum make every effort to review the material posted on this site however, it is not realistically possible for our staff to manually review each post.

The content of posts on this site, including but not limited to links to other web sites, are the expressed opinion of the original authors or posters and are not endorsed by, or representative of the opinions of, the owners or administration of this website. The posts on this website are the opinion of the specific author or poster and should not be construed as statements of advice or factual information.

Not all posts on this website are intended as truthful or factual assertion by their authors. NO posts on this website should be considered factual information on face value alone. Users are encouraged to USE DISCERNMENT and do their own follow up research while reading and posting on this website. FluTrackers.com Inc. reserves the right to make changes to, corrections and/or remove entirely at any time posts made on this website without notice. In addition, FluTrackers.com Inc. disclaims any and all liability for damages incurred directly or indirectly as a result of a post on this website.

This site is provided "as is" without warranty of any kind, either expressed or implied. You should not assume that this site is error-free or that it will be suitable for the particular purpose which you have in mind when using it. In no event shall FluTrackers.com Inc. be liable for any special, incidental, indirect or consequential damages of any kind, or any damages whatsoever, including, without limitation, those resulting from loss of use, data or profits, whether or not advised of the possibility of damage, and on any theory of liability, arising out of or in connection with the use or performance of this site or other documents which are referenced by or linked to this site.

Finally, FluTrackers.com Inc. reserves the right to delete, correct, or make changes to any post on this website without notice at any time for any reason.

Fair Use Notice:
This site may contain copyrighted material the use of which has not always been specifically authorized by the copyright owner. Users may make such material available in an effort to advance awareness and understanding of issues relating to public health, civil rights, economics, individual rights, international affairs, liberty, science & technology, etc. We believe this constitutes a 'fair use' of any such copyrighted material as provided for in section 107 of the US Copyright Law. In accordance with Title 17 U.S.C.Section 107, the material on this site is distributed to those who have expressed a prior interest in receiving the included information for research and educational purposes.

In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article. Please remember you are responsible for what you post on the internet and you could be sued by the original copyright holder if you do not honor these rules.

If you are a legal copyright holder or a designated agent for such and you believe a post on this website falls outside the boundaries of "Fair Use" and legitimately infringes on yours or your clients copyright

we may be contacted concerning copyright matters at:

FluTrackers.com Inc.
c/o Sharon Sanders
1676 Hibiscus Avenue
Winter Park, Florida 32789
Phone: 407-406-3037
E-Mail: flutrackers@earthlink.net

In accordance with section 512 of the U.S. Copyright Act our contact information has been registered with the United States Copyright Office. "Safe Harbor" noticing procedures as outlined in the DMCA apply to this website concerning all 3rd party posts published herein.

If notice is given of an alleged copyright violation we will act expeditiously to remove or disable access to the material(s) in question.

All 3rd party material posted on this website is the copyright of the respective owners / authors. FluTrackers.com Inc. makes no claim of copyright on such material.

For more information please visit: http://www.law.cornell.edu/uscode/17/107.shtml

Please be aware any communications sent complaining about a post on this website may be posted publicly at the discretion of the administration.

FluTrackers Does Not Provide Any Medical Advice:

FluTrackers, Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster.

The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website.

By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.

By using and/or accessing this site, either passively or actively, you are agreeing to all of the above conditions. Also, by using and/or accessing this site, either passively or actively, you agree to conduct all business and legal affairs related to this website in the jurisdiction of Flutrackers.com Inc. which is registered in Central Florida, USA.

These Disclaimers are subject to change at anytime.

Email the Webmaster with questions or comments about this site at flutrackers@earthlink.net


All times are GMT -4. The time now is 05:44 PM.