medpedia.com FluTrackers

Tracking Infectious Diseases since 2006

FluTrackers.com Inc. is a 501(c)(3) charity

Official PayPal Seal
H1N1 Swine Flu Information Información Gripe H1N1 Information Grippe H1N1 Influenza H1N1 Informazioni FluTrackers Latest Posts

www www.flutrackers.com



Go Back   FluTrackers > ** FLUTRACKERS SWINE FLU - A /H1N1 NEWS FORUM** > Asia > Thailand

Reply
 
Thread Tools Search this Thread Display Modes
  #1  
Old May 9th, 2009, 03:54 AM
FrenchieGirl's Avatar
FrenchieGirl FrenchieGirl is offline
Senior Moderator
 
Join Date: Jun 2006
Posts: 2,135
Default Thailand - H1N1 - 153 deaths

Public Health confirms suspect case of swine flu detected in Thailand

Thailand-Today.com
Breaking news and news headlines from Thailand in one place
www.Thailand-Today.com

Public Health permanent secretary Prat Boonyawongwiroj confirmed Saturday that a suspect case of Influenza A(H1N1) has been detected in Thailand.

He said the person is under quarantine and has been healed from the illness.

The Public Health Ministry has request a test by the a US lab to confirm the finding, Prat said.

The Nation
Reply With Quote
  #2  
Old May 9th, 2009, 01:23 PM
pablomorgan pablomorgan is offline
Senior User
 
Join Date: Apr 2009
Location: Liverpool
Posts: 622
Default Re: Thailand - One H1N1 suspect

http://nationmultimedia.com/2009/05/...l_30102302.php
Reply With Quote
  #3  
Old May 11th, 2009, 11:07 PM
Laidback Al Laidback Al is offline
Editor, Senior Moderator
 
Join Date: Feb 2006
Posts: 4,015
Default Re: Thailand - One H1N1 suspect

One patient suspected of contracting H1N1 virus: Health Ministry

BANGKOK, May 9 (TNA) – Of 10 patients now under close surveillance by Thailand’s Public Health Ministry suspected of contracting the deadly influenza A (H1N1), one is expected to have fallen victim to the disease, Minister Witthaya Kaewparadai announced on Saturday.
Without disclosing the identity of the patient -- in line with an agreement reached during a two-day meeting between public health ministers of the 10-member Association of Southeast Asian Nations along with China, Japan and South Korea, ended in Bangkok on Friday, Mr. Witthaya said the suspected victim had returned to Thailand from an area which was hit by the flu virus recently.

Medical laboratory tests showed that the person contracted the disease but confirmation cannot be made so the tests were sent to the US Centers for Disease Control and Prevention (CDC) on Thursday night for affirmation and it is expected that the result would be known within one week, Mr. Witthaya said.

Meanwhile, a spokesman for the Ministry’s Disease Control Department said the condition of the suspected patient is now improving after taking the antiviral drug Oseltamivir but is still under “close supervision” of doctors.

Family members of the suspected victim are also under special care and observation of the ministry officials, the spokesman added. (TNA)

http://enews.mcot.net/view.php?id=9853
Reply With Quote
  #4  
Old May 12th, 2009, 12:10 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - One H1N1 suspect

Quote:
Originally Posted by Laidback Al View Post
One patient suspected of contracting H1N1 virus: Health Ministry


Medical laboratory tests showed that the person contracted the disease but confirmation cannot be made so the tests were sent to the US Centers for Disease Control and Prevention (CDC) on Thursday night for affirmation and it is expected that the result would be known within one week, Mr. Witthaya said.


http://enews.mcot.net/view.php?id=9853
This is utter nonsense. The sequence was at Genbank on May 9:

Submitted (09-MAY-2009) National Influenza Center, Department of
Medical Sciences, 88/7 Ministry of Public Health Tiwanon Rd.,
Muang, Nonthaburi 11000, Thailand
Reply With Quote
  #5  
Old May 12th, 2009, 12:12 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - One H1N1 suspect

LOCUS GQ132184 284 bp cRNA linear VRL 09-MAY-2009
DEFINITION Influenza A virus (A/Nonthaburi/102/2009(H1N1)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION GQ132184
VERSION GQ132184.1 GI:229892685
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Nonthaburi/102/2009(H1N1))
ORGANISM Influenza A virus (A/Nonthaburi/102/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 284)
AUTHORS de Silva,J.W., Lukebua,A., Waicharoen,S. and Chitakanpitch,M.
TITLE First 2009 H1N1 Influenza (Swine Flu) Isolate from Thailand
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 284)
AUTHORS de Silva,J.W., Lukebua,A., Waicharoen,S. and Chitakanpitch,M.
TITLE Direct Submission
JOURNAL Submitted (09-MAY-2009) National Influenza Center, Department of
Medical Sciences, 88/7 Ministry of Public Health Tiwanon Rd.,
Muang, Nonthaburi 11000, Thailand
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
FEATURES Location/Qualifiers
source 1..284
/organism="Influenza A virus
(A/Nonthaburi/102/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Nonthaburi/102/2009"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon:644373"
/segment="4"
/country="Thailand"
/collection_date="2009"
/note="passaged in MDCK cells"
gene <1..>284
/gene="HA"
CDS <1..>284
/gene="HA"
/codon_start=2
/product="hemagglutinin"
/protein_id="ACQ89893.1"
/db_xref="GI:229892686"
/translation="SSDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKST
KLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSG"
ORIGIN
1 cagttcagat acaccagtcc acgattgcaa tacaacttgt cagacaccca agggtgctat
61 aaacaccagc ctcccatttc agaatataca tccgatcaca attggaaaat gtccaaaata
121 tgtaaaaagc acaaaattga gactggccac aggattgagg aatgtcccgt ctattcaatc
181 tagaggccta tttggggcca ttgccggttt cattgaaggg gggtggacag ggatggtaga
241 tggatggtac ggttatcacc atcaaaatga gcaggggtca ggat
Reply With Quote
  #6  
Old May 12th, 2009, 12:15 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - One H1N1 suspect

Quote:
Originally Posted by Laidback Al View Post
One patient suspected of contracting H1N1 virus: Health Ministry

BANGKOK, May 9 (TNA) –
Medical laboratory tests showed that the person contracted the disease but confirmation cannot be made so the tests were sent to the US Centers for Disease Control and Prevention (CDC) on Thursday night for affirmation and it is expected that the result would be known within one week, Mr. Witthaya said.

http://enews.mcot.net/view.php?id=9853
Anyone that has internet access and can copy and paste can confirm that the Thai H1N1 sequence at Genbank on May 9, A/Nonthaburi/102/2009(H1N1), was H1N1 swine flu

http://www.flutrackers.com/forum/sho...95&postcount=2
Reply With Quote
  #7  
Old May 12th, 2009, 12:44 AM
Laidback Al Laidback Al is offline
Editor, Senior Moderator
 
Join Date: Feb 2006
Posts: 4,015
Default Re: Thailand - One H1N1 suspect

Quote:
Sunday, May 10, 2009

Swine Flu case reported in Bangkok

PHUKET: The Public Health Ministry said yesterday it had detected a suspected first case of the deadly type A (H1N1) influenza in Thailand and is awaiting confirmation of the infection from the Center for Disease Control (CDC) in the United States. The result of the CDC's tests are expected within seven days.

No suspected cases of the type A (H1N1) virus have been found in Phuket or elsewhere in Thailand.

Public Health Minister Witthaya Kaewparadai told a press conference that monitoring by the Epidemiology Bureau in Bangkok had found 25 suspects from April 28 to Friday, most of whom had traveled to countries with outbreaks of the flu, and 15 of whom had been cleared. Ten remain in quarantine pending lab confirmation, he said.

One is suspected to have had A (H1N1), having returned from an outbreak country, but has recovered, Wittaya said. The ministry has already submitted that person's sample to the US CDC lab because Thailand has no sample of the A (H1N1) virus to compare with for confirmation, he said.

Declining to give details of the suspect, Wittaya affirmed that the ministry had everything under control with strict measures in place to prevent the virus spreading.

Chulalongkorn University virologist Yong Poovorawan applauded the ministry's submission of the sample to the CDC, as this was Thailand's first suspected case.

Dr Rungrueng Kitphati, chief of the Medical Science Department's International Health Regulation Coordination Centre, noted that samples had been sent abroad in the same way during the Sars and bird-flu scares.

The Thai Disease Control Department's spokesman, Dr Kamnuan Ungchusak, said the patient's samples had been sent to the US on Thursday evening.

The patient, who was well informed about the situation, had a fever on arrival in Thailand and had taken the antiviral drug Oseltamivir for five days until recovering, he added.

The ministry has been screening arrivals, especially from Mexico, the US, Canada, Spain and the UK, at Bangkok's Suvarnabhumi Airport since April 27. By Friday it had screened 404,134 passengers.

Monitoring of arrivals by air continues, with detection scanners out in force at Bangkok, Phuket and Chiangmai airports. Scanners have ordered and will soon be in place at land borders nationwide.

http://www.phuketgazette.net/news/index.asp?id=7331
It seems that a Thaivisa forum member also has concerns about the above news report.

geriatrickid wrote on May 12, 2009:

Quote:
An unsettling report and one that is an embarrassing admission. It also speaks to the lack of preparedness of Thailand to deal with this virus.

...is awaiting confirmation of the infection from the Center for Disease Control (CDC) in the United States. The result of the CDC's tests are expected within seven days. Sorry, but I believe that they wouldn't need to wait 7 days if they had invested in the facilities to do the cultures and mapping.

The ministry has already submitted that person's sample to the US CDC lab because Thailand has no sample of the A (H1N1) virus to compare with for confirmation, he said. Unacceptable and misleading. Both the US CDC and the Canadian National Microbiology Lab have made samples and genetic codes readily available. Any health agency can get access. To say that they have no sample is the equivalent of saying that Thailand doesn't have a sufficent quantity of intellectual capital to work with the codes. Even if a sample was given, what exactly would Thailand do with the sample? Where are the specialized labs needed to deal with the virus? Basically, what the article says is that Thailand is scientifically inept. Heartbreaking statement because there are some very good researchers in Thailand and if I was one of them and read this, I'd be insulted.

Samples have been made available to the labs that have the expertise.
Need proof? That small specimen container that blew a safety gasket on a Swiss train a couple weaks ago was a shared sample. On May 8, the BBC reported that Researchers at the US Centers for Disease Control and Prevention had already made genetic information on the swine flu virus publicly available to scientists around the world. The report then went on to discuss how the UK Health protection Agency was analyzing European samples using these codes. It's the genetic code of the virus that counts, not the virus itself when you need to identify the virus. How is it that tiny little New Zealand was able toundertake both genetic code and sample comparisons at Middlemore Hospital?

Chulalongkorn University virologist Yong Poovorawan applauded the ministry's submission of the sample to the CDC, as this was Thailand's first suspected case.
With all due respect to someone that has worked on avian flu and has a good reputation I wonder if he was quoted out of context. Is he applauding or lamenting the dispatch of samples. Just imagine what the professor could do if he had a state of the art lab, funding and a team of researchers.

The ministry has been screening arrivals, especially from Mexico, the US, Canada, Spain and the UK, at Bangkok's Suvarnabhumi Airport since April 27. By Friday it had screened 404,134 passengers.
So does this mean that countries that have cases get a free pass? What if they come in via another country like Taiwan or Malaysia? France, Italy and the UK and many other countries now have a significant number of cases. If you screen, you have to screen everyone, not just selected countries.

When I read articles like this, I feel for the Thai scientists and public health professionals. They deserve alot more respect than is shown.
http://www.thaivisa.com/forum/Swine-...k-t264266.html
Reply With Quote
  #8  
Old May 12th, 2009, 01:36 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - One H1N1 suspect

Actually, anyone who can google NCBI gets to the front page

http://www.ncbi.nlm.nih.gov/

Which has a center NOTICE for H1N1 sequences with this link

http://www.ncbi.nlm.nih.gov/genomes/FLU/SwineFlu.html
Which gives the page below with the Thai sequence among the most recent


The following 2009 H1N1 influenza virus sequences were submitted to NCBI and are available in GenBank:



<">




May 09, 2009, 48 submitted by Unknown Pathogen Investigation Collaborative Team (UPICT) and Instituto de Diangnostico y Referencia Epidemiologicos (inDRE), Canada/Mexico; 1 by Hospital Clinic, Spain; 1 by Korea Centers for Disease Control and Prevention, South Korea; 1 by National Influenza Center, Thailand; 1 by National Institute for Infectious Diseases L. Spallanzani, Italy:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/Canada-AB/RV1532/2009(H1N1))


GQ132140GQ132182GQ132174GQ132146GQ132164GQ132156GQ132151GQ132169
Influenza A virus
(A/Canada-NS/RV1536/2009(H1N1))


GQ132141GQ132183GQ132175GQ132147GQ132165GQ132158GQ132152GQ132170
Influenza A virus
(A/Canada-NS/RV1538/2009(H1N1))


GQ132136GQ132178GQ132172GQ132142GQ132160GQ132154GQ132148GQ132166
Influenza A virus
(A/Canada-ON/RV1526/2009(H1N1))


GQ132137GQ132180GQ132177GQ132143GQ132162GQ132159GQ132153GQ132171
Influenza A virus
(A/Canada-ON/RV1529/2009(H1N1))


GQ132139GQ132181GQ132173GQ132144GQ132163GQ132157GQ132149GQ132168
Influenza A virus
(A/Mexico/InDRE4114/2009(H1N1))


GQ132138GQ132179GQ132176GQ132145GQ132161GQ132155GQ132150GQ132167
Influenza A virus
(A/Catalonia/P48/2009(H1N1))


GQ132186
Influenza A virus
(A/Korea/01/2009(H1N1))


GQ132185
Influenza A virus
(A/Nonthaburi/102/2009(H1N1))


GQ132184
Influenza A virus
(A/Italy/09/2009(H1N1))


GQ132187

May 08, 2009, 3 submitted by The Swedish Institute for Infectious Disease Control,Sweden; 4 by Hospital Clinic, Spain; 4 by Korea Centers for Disease Control and Prevention, South Korea; 16 by JCVI; 1 by INMI L.Spallanzani, Italy:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/Catalonia/P148/2009(H1N1))


GQ122099GQ122100
Influenza A virus
(A/Catalonia/P154/2009(H1N1))


GQ122102GQ122101
Influenza A virus
(A/Stockholm/28/2009(H1N1))


GQ122105GQ122104GQ122103
Influenza A virus
(A/Korea/01/2009(H1N1))


GQ131023GQ131024GQ131025GQ131026
Influenza A Virus
(A/New York/1669/2009(H1N1))


CY039900CY039899CY039898CY039893CY039896CY039895CY039894CY039897
Influenza A Virus
(A/New York/1682/2009(H1N1))


CY039908CY039907CY039906CY039901CY039904CY039903CY039902CY039905
Influenza A virus
(A/Italy/08/2009(H1N1))


GQ132135

May 07, 2009, 1 by Unknown Pathogen Investigation Collaborative Team (UPICT) and Instituto de Diangnostico y Referencia Epidemiologicos (inDRE), Canada/Mexico; 6 by CDC; 1 by WHO National Influenza Centre, New Zealand:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/Canada-NS/RV1535/2009(H1N1))


GQ120442
Influenza A virus
(A/Christchurch/2/2009(H1N1))


GQ122098
Influenza A virus
(A/Texas/15/2009(H1N1))


GQ122094GQ122097GQ122092GQ122096GQ122095GQ122093

May 06, 2009, 102 submitted by CDC:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/Arizona/01/2009(H1N1))


GQ117067GQ117063GQ117064GQ117066GQ117065
Influenza A virus
(A/Arizona/02/2009(H1N1))


GQ117076GQ117075GQ117079GQ117074GQ117077GQ117078
Influenza A virus
(A/California/04/2009(H1N1))


GQ117044
Influenza A virus
(A/California/14/2009(H1N1))


GQ117035GQ117034GQ117037GQ117040GQ117033GQ117036GQ117039GQ117038
Influenza A virus
(A/Colorado/03/2009(H1N1))


GQ117119GQ117117GQ117118
Influenza A virus
(A/Indiana/09/2009(H1N1))


GQ117093GQ117095GQ117097GQ117092GQ117094GQ117096
Influenza A virus
(A/Kansas/02/2009(H1N1))


GQ117059GQ117057GQ117058
Influenza A virus
(A/Kansas/03/2009(H1N1))


GQ117062GQ117060GQ117061
Influenza A virus
(A/Massachusetts/06/2009(H1N1))


GQ117043GQ117041GQ117042
Influenza A virus
(A/Massachusetts/07/2009(H1N1))


GQ117103GQ117101GQ117102
Influenza A virus
(A/Michigan/02/2009(H1N1))


GQ117109GQ117112GQ117107GQ117108GQ117111GQ117110
Influenza A virus
(A/Minnesota/02/2009(H1N1))


GQ117070GQ117069GQ117068GQ117071GQ117073GQ117072
Influenza A virus
(A/Nebraska/02/2009(H1N1))


GQ117104GQ117105GQ117106
Influenza A virus
(A/New York/09/2009(H1N1))


GQ117120
Influenza A virus
(A/New York/13/2009(H1N1))


GQ117115GQ117116GQ117113GQ117114
Influenza A virus
(A/New York/20/2009(H1N1))


GQ117082
GQ117086


GQ117080
GQ117083


GQ117081
GQ117084


GQ117085
Influenza A virus
(A/New York/22/2009(H1N1))


GQ117021GQ117020GQ117024GQ117019GQ117022GQ117023
Influenza A virus
(A/Ohio/07/2009(H1N1))


GQ117100GQ117098GQ117099
Influenza A virus
(A/South Carolina/09/2009(H1N1))


GQ117056GQ117052GQ117053GQ117055GQ117054
Influenza A virus
(A/Texas/07/2009(H1N1))


GQ117089GQ117088GQ117091GQ117087GQ117090
Influenza A virus
(A/Texas/08/2009(H1N1))


GQ117047GQ117046GQ117049GQ117051GQ117045GQ117048GQ117050
Influenza A virus
(A/Texas/09/2009(H1N1))


GQ117027GQ117026GQ117029GQ117032GQ117025GQ117028GQ117031GQ117030

May 05, 2009, 20 submitted by Instituto de Salud Carlos III, Spain; 3 by National Institute for Infectious Diseases 'Lazzaro Spallanzani', Italy; 4 by Israel Central Virology Laboratory, 23 by Unknown Pathogen Investigation Collaborative Team (UPICT) and Instituto de Diangnostico y Referencia Epidemiologicos (inDRE), Canada/Mexico:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/Castilla-La Mancha/GP13/2009(H1N1))


FJ985753FJ985751FJ985754FJ985750FJ985752
Influenza A virus
(A/Castilla-La Mancha/GP9/2009(H1N1))


FJ985768FJ985766FJ985769FJ985765FJ985767
Influenza A virus
(A/Pais Vasco/GP20/2009(H1N1))


FJ985763FJ985761FJ985764FJ985760FJ985762
Influenza A virus
(A/Valencia/GP4/2009(H1N1))


FJ985758FJ985756FJ985759FJ985755FJ985757
Influenza A virus
(A/Italy/03/2009(H1N1))


FJ985804
Influenza A virus
(A/Italy/04/2009(H1N1))


FJ985805
Influenza A virus
(A/Italy/02/2009(H1N1))


FJ997636
Influenza A virus
(A/Israel/G-640/2009(H1N1))


FJ986328
Influenza A virus
(A/Israel/G-645/2009(H1N1))


FJ986329
Influenza A virus
(A/Israel/MF-119/2009(H1N1))


FJ986331
Influenza A virus
(A/Israel/MF-70/2009(H1N1))


FJ986330
Influenza A virus
(A/Canada-NS/RV1535/2009(H1N1))


FJ998225FJ998222FJ998207FJ998216FJ998213FJ998210FJ998219
Influenza A virus
(A/Canada-ON/RV1527/2009(H1N1))


FJ998205FJ998227FJ998224FJ998209FJ998218FJ998215FJ998212FJ998221
Influenza A virus
(A/Mexico/InDRE4487/2009(H1N1))


FJ998206FJ998226FJ998223FJ998208FJ998217FJ998214FJ998211FJ998220

May 04, 2009, 4 submitted by Statens Serum Institut, Denmark; 1 by Azienda Ospedaliero-Universitaria Pisana, Italy; 1 by Istituto Superiore di Sanita, Italy; 68 by CDC; 1 by University of Regensburg, Germany:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/Denmark/513/2009(H1N1))


FJ982430FJ982431FJ982432FJ982433
Influenza A virus
(A/Italy/01/2009(H1N1))


FJ982434
Influenza A virus
(A/Italy/02/2009(H1N1))


FJ984583
Influenza A virus
(A/California/07/2009(H1N1))


FJ984387FJ984386
Influenza A virus
(A/California/08/2009(H1N1))


FJ984365FJ984367FJ984368FJ984366
Influenza A virus
(A/New York/06/2009(H1N1))


FJ984341FJ984340FJ984338FJ984339
Influenza A virus
(A/New York/10/2009(H1N1))


FJ984373FJ984374FJ984375FJ984372FJ984371FJ984369FJ984370
Influenza A virus
(A/New York/11/2009(H1N1))


FJ984346FJ984347FJ984345FJ984344FJ984342FJ984343
Influenza A virus
(A/New York/12/2009(H1N1))


FJ984337FJ984336FJ984335FJ984334
Influenza A virus
(A/New York/15/2009(H1N1))


FJ984380FJ984379FJ984378FJ984376FJ984377
Influenza A virus
(A/New York/18/2009(H1N1))


FJ984351FJ984353FJ984354FJ984355FJ984352FJ984350FJ984348FJ984349
Influenza A virus
(A/New York/19/2009(H1N1))


FJ984392FJ984393FJ984394FJ984391FJ984390FJ984388FJ984389
Influenza A virus
(A/New York/23/2009(H1N1))


FJ984364FJ984363FJ984362FJ984361
Influenza A virus
(A/New York/31/2009(H1N1))


FJ984359FJ984360FJ984358FJ984357FJ984356
Influenza A virus
(A/Ohio/07/2009(H1N1))


FJ984400FJ984397
FJ984401


FJ984396FJ984395
FJ984398


FJ984399
Influenza A virus
(A/Texas/06/2009(H1N1))


FJ984385FJ984384FJ984383FJ984381FJ984382
Influenza A virus
(A/Regensburg/Germany/01/2009(H1N1))


FJ984953

May 1, 2009, 13 submitted by CDC; 1 by University of Geneva, Switzerland:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/California/07/2009(H1N1))


FJ981613
Influenza A virus
(A/Switzerland/01/2009(H1N1))


FJ981646
Influenza A virus
(A/Texas/04/2009(H1N1))


FJ981616FJ981619FJ981612
FJ981615


FJ981618FJ981614FJ981617FJ981620
Influenza A virus
(A/Texas/05/2009(H1N1))


FJ981610FJ981609FJ981608FJ981611

April 30, 2009, 6 submitted by WHO CC for Reference and Research on Influenza, Australia; 1 by University of Regensburg, Germany; 7 by Ontario Agency for Health Protection and Promotion, Canada; 2 by Erasmus MC Rotterdam, Netherlands:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/Auckland/3/2009(H1N1))


FJ973552FJ973553
Influenza A virus
(A/Auckland/2/2009(H1N1))


FJ973554
Influenza A virus
(A/Auckland/1/2009(H1N1))


FJ973557FJ973555FJ973556
Influenza A virus
(A/Regensburg/Germany/01/2009(H1N1))


FJ974021
Influenza A virus
(A/Toronto/3181/2009(H1N1))


FJ974022
Influenza A virus
(A/Toronto/3170/2009(H1N1))


FJ974023
Influenza A virus
(A/Toronto/3184/2009(H1N1))


FJ974024
Influenza A virus
(A/Toronto/3178/2009(H1N1))


FJ974025
Influenza A virus
(A/Toronto/3141/2009(H1N1))


FJ974026
Influenza A virus
(A/Toronto/3145/2009(H1N1))


FJ974027
Influenza A virus
(A/Toronto/3146/2009(H1N1))


FJ974028
Influenza A virus
(A/Netherlands/602/2009(H1N1))


CY039527CY039528

April 29, 2009, 1 submitted by University of Regensburg, Germany; 3 by CDC:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/Regensburg/Germany/01/2009(H1N1))


FJ970928
Influenza A virus
(A/California/06/2009(H1N1))


FJ971075FJ971074
Influenza A virus
(A/California/08/2009(H1N1))


FJ971076

April 28, 2009, 34 submitted by CDC:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/New York/19/2009(H1N1))


FJ969509
Influenza A virus
(A/New York/20/2009(H1N1))


FJ969542FJ969541
Influenza A virus
(A/Kansas/03/2009(H1N1))


FJ969523
Influenza A virus
(A/Ohio/07/2009(H1N1))


FJ969521
FJ969535


FJ969520
FJ969534


Influenza A virus
(A/California/04/2009(H1N1))


FJ969516FJ969515FJ969512FJ969517FJ969513FJ969514
Influenza A virus
(A/California/07/2009(H1N1))


FJ969530FJ969531FJ969529
FJ969539


FJ969540FJ969536FJ969527
FJ969537


FJ969528
FJ969538


Influenza A virus
(A/California/08/2009(H1N1))


FJ969518
FJ969532


FJ969519
FJ969533


Influenza A virus
(A/California/10/2009(H1N1))


FJ969511FJ969510
Influenza A virus
(A/Texas/04/2009(H1N1))


FJ969525FJ969526FJ969524
Influenza A virus
(A/Texas/05/2009(H1N1))


FJ969522

April 27, 2009, 40 submitted by CDC:
PB2PB1PAHANPNAMPNS
Influenza A virus
(A/California/04/2009(H1N1))


FJ966079FJ966080FJ966081FJ966082FJ966083FJ966084FJ966085FJ966086
Influenza A virus
(A/California/05/2009(H1N1))


FJ966955FJ966958FJ966957FJ966952FJ966953FJ966956FJ966954
Influenza A virus
(A/California/06/2009(H1N1))


FJ966963FJ966965FJ966964FJ966960FJ966961FJ966962
Influenza A virus
(A/California/07/2009(H1N1))


FJ966976FJ966978FJ966977FJ966974FJ966975
Influenza A virus
(A/California/09/2009(H1N1))


FJ966971FJ966973FJ966972
Influenza A virus
(A/Texas/04/2009(H1N1))


FJ966982FJ966979FJ966981FJ966980
FJ966983


Influenza A virus
(A/Texas/05/2009(H1N1))


FJ966970FJ966959FJ966967FJ966969FJ966968FJ966966

Flu.govFlu.govShare This Widget
Flu.govFlu.govShare This Widget

Last edited by AlaskaDenise; October 3rd, 2009 at 11:30 PM. Reason: remove ad
Reply With Quote
  #9  
Old May 12th, 2009, 01:50 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - One H1N1 suspect

Chulalongkorn University virologist Yong Poovorawan applauded the ministry's submission of the sample to the CDC, as this was Thailand's first suspected case.
With all due respect to someone that has worked on avian flu and has a good reputation I wonder if he was quoted out of context. Is he applauding or lamenting the dispatch of samples. Just imagine what the professor could do if he had a state of the art lab, funding and a team of researchers.

Actually, Yong has a world class sequencing lab (although he just does animal sequences) and was one of the first to get H5N1 sequences published at Genbank (in Febraury, 2004), including sequences from the dead tigers.

However, the partial sequence at GenBank leaves NO doubt that the Thai sequences were from HA from the same swine H1N1 that is circling the globe, as transmission is SUSTAINED.
Reply With Quote
  #10  
Old May 12th, 2009, 03:31 AM
Dutchy's Avatar
Dutchy Dutchy is offline
Editor, Senior Moderator
 
Join Date: Aug 2006
Location: Netherlands
Posts: 10,613
Default Re: Thailand - One H1N1 suspect

Tuesday May 12, 2009

Thailand confirms first H1N1 flu case

BANGKOK (Reuters) - Thailand confirmed its first case of the H1N1 flu on Tuesday, but the patient has recovered and there were no reports of more infections, Prime Minister Abhisit Vejjajiva said.

The Public Health Ministry has scheduled a news conference for 2 p.m. (0700 GMT) to discuss the test results confirmed by the U.S.-based Centers for Disease Control (CDC).


A child wearing a surgical mask talks on a phone in San Jose, May 11, 2009. (REUTERS/Juan Carlos Ulate)
"The returned lab result confirmed that it was the infection, but the person has recovered from it," Abhisit told reporters.

The World Health Organization (WHO) has confirmed 4,379 infections worldwide, with the worst impact in North America, where 60 people have died.

Despite the small number of cases to date in Asia, health experts say the region cannot afford to be complacent after bouts of SARS and bird flu in recent years.

Last week, health ministers from 13 Asian countries agreed in Bangkok to boost antiviral drug stockpiles and tighten surveillance against the virus, also known as swine flu.

The global spread of the virus has raised concerns about a possible pandemic, although scientists say this strain does not appear more deadly than seasonal flu.

Nevertheless, the impact of H1N1 on global travel has added to the gloom in Thailand's tourist industry, which has already suffered a sharp drop in arrivals due to the global economic crisis and political unrest at home.

http://thestar.com.my/news/story.asp...c=Worldupdates
Reply With Quote
  #11  
Old May 12th, 2009, 03:44 AM
nomadic wench nomadic wench is offline
Senior User
 
Join Date: May 2009
Posts: 145
Default Re: Thailand - One H1N1 suspect

I'm surprised they can't do the sequencing themselves too. Chulalongkorn and Mahidol universities do some good research and some of the hospitals in Bangkok are more state of the art than anything I've seen in Europe. Lots of very expensive equipment.

I thought I saw the WHO or CDC asking governments to send them samples for confirmation somewhere. Maybe they don't update their stats until they see for themselves?
Reply With Quote
  #12  
Old May 12th, 2009, 03:50 AM
Dutchy's Avatar
Dutchy Dutchy is offline
Editor, Senior Moderator
 
Join Date: Aug 2006
Location: Netherlands
Posts: 10,613
Default Re: Thailand - One H1N1 suspect

Quote:
Originally Posted by nomadic wench View Post
I'm surprised they can't do the sequencing themselves too. Chulalongkorn and Mahidol universities do some good research and some of the hospitals in Bangkok are more state of the art than anything I've seen in Europe. Lots of very expensive equipment.

I thought I saw the WHO or CDC asking governments to send them samples for confirmation somewhere. Maybe they don't update their stats until they see for themselves?

Being no expert at all, I have been told you need a primer for a PCR-test.

Could it be is simple as this:

No one took the initiative to design a primer for A/H1N1 in Thailand?

WHO did not distribute the primer to countries which could need it?

I suppose (many) other countries could have the same problem ?
Reply With Quote
  #13  
Old May 12th, 2009, 06:03 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - One H1N1 suspect

Quote:
Originally Posted by Dutchy View Post
Being no expert at all, I have been told you need a primer for a PCR-test.

Could it be is simple as this:

No one took the initiative to design a primer for A/H1N1 in Thailand?

WHO did not distribute the primer to countries which could need it?

I suppose (many) other countries could have the same problem ?
No, that's not the problem. Like H5N1, H1N1 is ALL about politics.

The sequence at Genbank, deposited on May 9, was depsited by THAI researchers (no CDC required).

AUTHORS de Silva,J.W., Lukebua,A., Waicharoen,S. and Chitakanpitch,M.
TITLE Direct Submission
JOURNAL Submitted (09-MAY-2009) National Influenza Center, Department of
Medical Sciences, 88/7 Ministry of Public Health Tiwanon Rd.,
Muang, Nonthaburi 11000, Thailand
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
Reply With Quote
  #14  
Old May 12th, 2009, 06:16 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 confirmed

I think the politics of this confirmation is of interest.

On May 9, researchers in Thailand submitted a partial Ha sequence from a patient in,Nonthaburi, Thailand (A/Nonthaburi/102/2009). Although the sequence was only a patial sequence, it was virtiually identical to swine H1N1 desposited at Genbank and GISAID by researchers around the world. A BLAST of the sequence at Genbank (which takes less than 5 seconds) leaves no doubt that the isollate is swine H1N1.

The official announcement states that there is lab data supporting a swine flu diagnosis, but confimration at the CDC is required and will take a week.

However, Genbank is releasing sequences in real time, so on May 9 it was clear to anyone who looked at the front page of the site, that H1N1 had been confirmed in Thailand, providing additional evidence os SUSTAINED transmission of H1N1 outside of North America.
Reply With Quote
  #15  
Old May 12th, 2009, 06:19 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 confirmed

INFLUENZA VIRUSES ISOLATED BY
WHO/NREVSS Collaborating Laboratories
2008 - 2009 Season
WeekA(H1)A(Novel H1N1)A(H3)A(Could Not Subtyped)A(Unk)B Total # Tested% Positive
40 3 0 0 0 8 6 2574 0.66
41 4 0 4 0 8 6 2593 0.85
42 13 0 3 0 15 6 2698 1.37
43 22 0 0 0 24 14 3155 1.9
44 12 0 3 0 21 5 3262 1.26
45 32 0 2 0 23 11 3858 1.76
46 25 0 2 0 23 12 4089 1.52
47 27 0 1 0 31 23 4461 1.84
48 40 0 1 0 47 24 4570 2.45
49 43 0 6 0 57 14 5253 2.28
50 71 0 9 0 66 37 5664 3.23
51 73 0 19 0 108 56 5956 4.3
52 71 0 12 0 153 51 5731 5.01
53 115 0 19 0 171 48 6211 5.68
01 165 0 27 0 285 82 6598 8.47
02 196 0 22 0 423 96 6640 11.1
03 340 0 44 0 623 186 7486 15.94
04 558 0 77 0 898 359 8896 21.27
05 674 0 52 0 1359 672 11346 24.3
06 814 0 63 0 1337 911 12372 25.26
07 817 0 65 1 1068 894 11378 25
08 669 0 59 1 1002 1097 11598 24.38
09 527 0 57 0 882 1086 10342 24.68
10 353 0 63 0 638 1002 9106 22.58
11 346 0 62 0 429 873 8160 20.96
12 257 0 41 0 281 597 6707 17.53
13 107 1 25 0 163 430 5115 14.19
14 87 0 31 1 122 246 4357 11.18
15 37 0 28 0 70 158 3810 7.69
16 39 8 31 5 76 86 3164 7.74
17 370 524 343 259 269 338 14928 14.09
Reply With Quote
  #16  
Old May 12th, 2009, 07:37 AM
Dutchy's Avatar
Dutchy Dutchy is offline
Editor, Senior Moderator
 
Join Date: Aug 2006
Location: Netherlands
Posts: 10,613
Default Re: Thailand - A / H1N1 confirmed

It seems to be TWO patients.

Tuesday, May 12, 2009

Thailand reports first confirmed case of swine flu

The Associated Press , Bangkok | Tue, 05/12/2009 4:02 PM | World

Thailand's health minister announced Tuesday that the Southeast Asian country had confirmed its first cases of swine flu in two people who had recently returned from Mexico, and both wre recovering.

Health Minister Witthaya Keawparadai declined to disclose details about the patients, citing doctor-patient confidentiality and the fact that both were recovering.

"We have confirmed two cases of H1N1 influenza A," Witthaya told a news conference. "There is no outbreak in Thailand." The cases in Thailand also marked the official arrival of swine flu in Southeast Asia. Other countries on the continent have reported cases, including China, Japan and South Korea.

Shortly before the news conference, Prime Minister Abhisit Vejjajiva had told reporters that authorities had confirmed Thailand's first case of swine flu in a single male patient.

He said health authorities had sent a sample from the patient last week to the U.S. Centers for Disease Control for final testing.

"The U.S. has confirmed the case," Abhisit told reporters, adding, "I understand he is safe ... He has recovered, as far as I know."

http://www.thejakartapost.com/news/2...swine-flu.html
Reply With Quote
  #17  
Old May 12th, 2009, 07:50 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 cases confirmed

Commentary
Reply With Quote
  #18  
Old May 12th, 2009, 08:22 AM
FluBossie FluBossie is offline
Senior User
 
Join Date: Aug 2006
Location: Netherlands
Posts: 147
Default Re: Thailand - A / H1N1 cases confirmed

Thailand says two flu patients visited Mexico

Tue May 12, 2009 9:14am BST

BANGKOK (Reuters) - Two Thais who returned from Mexico have been confirmed with H1N1 flu but have recovered from the virus, Health Minister Witthaya Kaewparadai said on Tuesday.
Eight other Thais who were in contact with the two infected people were released after being quarantined for a week and show no signs of the virus, he said.
"We have found two confirmed cases of the flu, which was contracted abroad. They have recovered," Witthaya told a news conference.
He gave no details of the two patients and did not say when or where they had travelled in Mexico, the epicentre of the outbreak also known as swine flu.
The World Health Organisation has confirmed 4,379 infections worldwide, with the worst impact in North America, where 60 people have died, mostly in Mexico.
Despite the small number of cases to date in Asia, health experts say the region cannot afford to be complacent after bouts of SARS and bird flu in recent years.
Last week, health ministers from 13 Asian countries agreed in Bangkok to boost antiviral drug stockpiles and tighten surveillance against the virus.
The global spread of the virus has raised concerns about a possible pandemic, although scientists say this strain does not appear more deadly than seasonal flu.
Nevertheless, the impact of H1N1 on global travel has added to the gloom in Thailand's tourist industry, which has already suffered a sharp drop in arrivals due to the global economic crisis and political unrest at home.
(Reporting by Kittipong Soonprasert; Writing by Darren Schuettler; Editing by Alan Raybould and Dean Yates)


© Thomson Reuters 2009 All rights reserved.

http://uk.reuters.com/article/worldN...54B0ZO20090512
Reply With Quote
  #19  
Old May 12th, 2009, 08:29 AM
nomadic wench nomadic wench is offline
Senior User
 
Join Date: May 2009
Posts: 145
Default Re: Thailand - A / H1N1 cases confirmed

Well Thailand has had a lot of concerns about its tourism industry lately...anti-government riots and airport closures as well as SARS, birdflu and economic crisis etc so they could be tempted to keep it quiet. However as countries like the US are far more affected right now it wouldn't make much sense to be secretive.

Just saw Muscade has posted about a second confirmed case in the French section.

Quote:
Les échantillons de virus prélevés sur le patient ont été envoyés au Centre américain pour le contrôle des maladies (USCDC, en sigle anglais) et ce dernier a confirmé au gouvernement thaïlandais que le patient était infecté à la grippe A/H1N1, a fait savoir M. Witthaya.
En ce qui concerne le deuxième cas, le ministre a précisé que le patient s'était senti souffrant avec une fièvre modérée trois jours après son arrivée en Thaïlande, alors que les tests de laboratoire ont également confirmé que le second cas avait été infecté par la grippe A/H1N1.

My amateur translation.

Quote:
Samples taken from the patient were sent to the CDC and the latter confirmed to the Thai government. that the patient was infected by influenza A/H1N1, said Mr Witthaya.

As for the second case, the minister specified that the patient felt ill with a moderate fever three days after his arrival in Thailand, and tests have also confirmed the second case had been infected with influenza A/H1N1
Maybe the Thai govt just needed confirmation too before announcing the first case? No mention of CDC for the second case.
Reply With Quote
  #20  
Old May 12th, 2009, 08:36 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 cases confirmed

Quote:
Originally Posted by nomadic wench View Post
Well Thailand has had a lot of concerns about its tourism industry lately...anti-government riots and airport closures as well as SARS, birdflu and economic crisis etc so they could be tempted to keep it quiet. However as countries like the US are far more affected right now it wouldn't make much sense to be secretive.

Just saw Muscade has posted about a second confirmed case in the French section.




My amateur translation.



Maybe the Thai govt just needed confirmation too before announcing the first case? No mention of CDC for the second case.
H1N1, like H5N1 is ALL about politics (no science required).
There was NO doubt on May 9 that swine H1N1 was in patients in Thailand.
Reply With Quote
  #21  
Old May 12th, 2009, 08:36 AM
Sally Furniss's Avatar
Sally Furniss Sally Furniss is online now
Managing Editor - Vice President
 
Join Date: Feb 2006
Location: Christchurch, New Zealand
Posts: 9,168
Default Re: Thailand - A / H1N1 cases confirmed

More on the second

The Thai government Tuesday confirmed that two cases of influenza A H1N1 have been detected in the kingdom, both patients had caught the virus while in Mexico.

Lab results from the Centre for Disease Control in the United States had confirmed the A(H1N1) virus in samples from two suspected swine-flu patients from Thailand
, Thai Health Minister Wittaya Geowparadai told a press conference.

"Both patients caught the virus is Mexico," Wittaya said.

The first patient, a 42-year-old Thai woman who visited Mexico last month on a seminar, was admitted to Chulalongkorn Hospital last month after showing flu-like symptoms. Health authorities initially said the woman was only suffering from human flu, but lab tests from the US proved them wrong.

The second suspected case was announced on Saturday, and confirmed by US lab results Tuesday. "Both patients have been given anti-viral drugs and have fully recovered," Wittaya said.

He added that people who had some in close contact with the two patients had been put under quarantine and given anti-viral drugs.


Thailand has imposed a host of preventative measures against the spread of A H1N1, including planting heat-seeking devices at the country's main international airports to detect arrivals suffering from fever. The country has a stockpile of 1.32 million tablets of oseltamivir and the health ministry Tuesday asked for an extra budget to buy enough raw materials to locally produce another 2 million oseltamivir tablets.

http://www.earthtimes.org/articles/s...--summary.html
__________________
How did Christchurch cope in the 1918 influenza Pandemic

New Zealand H1N1 news and response
One generation plants the trees; another gets the shade - Chinese proverb
Reply With Quote
  #22  
Old May 12th, 2009, 08:48 AM
nomadic wench nomadic wench is offline
Senior User
 
Join Date: May 2009
Posts: 145
Default Re: Thailand - A / H1N1 cases confirmed

Can I interrupt a second and ask about Dr Niman's graph. Those "could not be sub-typed" A viruses... could they be the first mutations of H1N1? Suddenly 5 at the bottom.
Reply With Quote
  #23  
Old May 12th, 2009, 08:52 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 cases confirmed

Quote:
Originally Posted by nomadic wench View Post
Can I interrupt a second and ask about Dr Niman's graph. Those "could not be sub-typed" A viruses... could they be the first mutations of H1N1?
No. That column just represents a testing backlog. 97% of "could not be sub-typed" are subsequently sub-typed as swine H1N1 (see table, which has updated data showing swine H1N1 increasing as "untypable" decreases).
The CDC data are close to "real time".
Reply With Quote
  #24  
Old May 12th, 2009, 08:54 AM
nomadic wench nomadic wench is offline
Senior User
 
Join Date: May 2009
Posts: 145
Default Re: Thailand - A / H1N1 cases confirmed

Ah, thank you.
Reply With Quote
  #25  
Old May 12th, 2009, 08:59 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 cases confirmed

Quote:
Originally Posted by nomadic wench View Post
Ah, thank you.
Here is the data from the original report

Week 17
No. of specimens tested14,330
No. of positive specimens (%)1,892 (13.2%)
Positive specimens by type/subtype
Influenza A1,572 (83.1%)
A (H1) 334 (21.3%)
A (H3) 300 (19.1%)
A (unsubtyped) 308 (19.6%)
A (could not be subtyped) 304 (19.3%)
A (novel influenza H1N1) 326 (20.7%)
Influenza B320 (16.9%)
Reply With Quote
  #26  
Old May 12th, 2009, 09:01 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 cases confirmed

Here's the updated data (as of today)
17 370 524 343 259 269 338 14928 14.09


Novel H1N1 rose from 326 to 524, while "could not be subtyped" fell from 304 to 259 (and specimens tested rose from 14,330 to 14,928).
Reply With Quote
  #27  
Old May 12th, 2009, 12:55 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 cases confirmed

Quote:
Originally Posted by Sally View Post
More on the second

The Thai government Tuesday confirmed that two cases of influenza A H1N1 have been detected in the kingdom, both patients had caught the virus while in Mexico.

Lab results from the Centre for Disease Control in the United States had confirmed the A(H1N1) virus in samples from two suspected swine-flu patients from Thailand, Thai Health Minister Wittaya Geowparadai told a press conference.

"Both patients caught the virus is Mexico," Wittaya said.

The first patient, a 42-year-old Thai woman who visited Mexico last month on a seminar, was admitted to Chulalongkorn Hospital last month after showing flu-like symptoms. Health authorities initially said the woman was only suffering from human flu, but lab tests from the US proved them wrong.

The second suspected case was announced on Saturday, and confirmed by US lab results Tuesday. "Both patients have been given anti-viral drugs and have fully recovered," Wittaya said.

He added that people who had some in close contact with the two patients had been put under quarantine and given anti-viral drugs.

Thailand has imposed a host of preventative measures against the spread of A H1N1, including planting heat-seeking devices at the country's main international airports to detect arrivals suffering from fever. The country has a stockpile of 1.32 million tablets of oseltamivir and the health ministry Tuesday asked for an extra budget to buy enough raw materials to locally produce another 2 million oseltamivir tablets.

http://www.earthtimes.org/articles/s...--summary.html
The sequence at Genbank came from the 42F based on the location of the hospital

[Maps
Reply With Quote
  #28  
Old May 12th, 2009, 02:10 PM
nomadic wench nomadic wench is offline
Senior User
 
Join Date: May 2009
Posts: 145
Default Re: Thailand - A / H1N1 cases confirmed

Quote:
Health authorities initially said the woman was only suffering from human flu, but lab tests from the US proved them wrong.
I see what you mean Dr Niman but the patient was admitted last month. The gene sequences were available on May 9th. Were the Thai health authorities referring to the initial dx last month or were they deliberately covering up?

Did they keep saying it was seasonal flu after the sequences were known?
Reply With Quote
  #29  
Old May 12th, 2009, 02:36 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Thailand - A / H1N1 cases confirmed

Quote:
Originally Posted by nomadic wench View Post
I see what you mean Dr Niman but the patient was admitted last month. The gene sequences were available on May 9th. Were the Thai health authorities referring to the initial dx last month or were they deliberately covering up?

Did they keep saying it was seasonal flu after the sequences were known?
My guess is that a month ago they were worried about H5N1, so when the sample was infleunza A positive, but H5N1 negative, they assumed it was a seasonal flu infection. Then when they heard about swine H1N1, the retested with swine H1N1 primers, and when they got a positive, they sequenced teh insert, which is what was sent to Genbank on Saturday.
Reply With Quote
  #30  
Old May 14th, 2009, 01:17 AM
Laidback Al Laidback Al is offline
Editor, Senior Moderator
 
Join Date: Feb 2006
Posts: 4,015
Default Re: Thailand - A / H1N1 cases confirmed

Thailand reports another suspected A/H1N1 flu case

BANGKOK, May 14 (Xinhua) -- Thailand reported another suspectedA/H1N1 flu infection case Thursday after a provincial hospital late Wednesday night admitted and quarantined a university lecturer who developed high fever following his foreign trip.
The lecturer of Rajabhat University Ayuddhaya has been to Italy, France, Switzerland, Belgium and Egypt from May 1 to 10, with 25 people travelled with him during the foreign trip. Medical staff are preparing to search for these 25 people to prevent the spread.
The hospital of Ayudhya province, nearby Thai capital Bangkok, has taken the lecturer's blood sample for testing, to confirm whether he contracted the A/H1N1 flu virus.
The lecturer, whose name was not disclosed, is the first flu-infected suspect reported in Thailand since two flu infection case were confirmed on May 12.
According to updates from World Health Organization (WHO), there have been at least 5,728 confirmed A/H1N1 flu-infection case across the world, and at least 61 people died of the new flu strain.

http://news.xinhuanet.com/english/20...t_11372662.htm
Reply With Quote
Reply

Tags
case count, deaths, disease, epidemic, flu, h1n1, infection, influenza, pandemic, swine flu, thailand, vaccine, virus, w.h.o.


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is On

Disclaimer:

The reader is responsible for discerning the validity, factuality or implications of information posted here, be it fictional or based on real events. Moderators on this forum make every effort to review the material posted on this site however, it is not realistically possible for our staff to manually review each post.

The content of posts on this site, including but not limited to links to other web sites, are the expressed opinion of the original authors or posters and are not endorsed by, or representative of the opinions of, the owners or administration of this website. The posts on this website are the opinion of the specific author or poster and should not be construed as statements of advice or factual information.

Not all posts on this website are intended as truthful or factual assertion by their authors. NO posts on this website should be considered factual information on face value alone. Users are encouraged to USE DISCERNMENT and do their own follow up research while reading and posting on this website. FluTrackers.com Inc. reserves the right to make changes to, corrections and/or remove entirely at any time posts made on this website without notice. In addition, FluTrackers.com Inc. disclaims any and all liability for damages incurred directly or indirectly as a result of a post on this website.

This site is provided "as is" without warranty of any kind, either expressed or implied. You should not assume that this site is error-free or that it will be suitable for the particular purpose which you have in mind when using it. In no event shall FluTrackers.com Inc. be liable for any special, incidental, indirect or consequential damages of any kind, or any damages whatsoever, including, without limitation, those resulting from loss of use, data or profits, whether or not advised of the possibility of damage, and on any theory of liability, arising out of or in connection with the use or performance of this site or other documents which are referenced by or linked to this site.

Finally, FluTrackers.com Inc. reserves the right to delete, correct, or make changes to any post on this website without notice at any time for any reason.

Fair Use Notice:
This site may contain copyrighted material the use of which has not always been specifically authorized by the copyright owner. Users may make such material available in an effort to advance awareness and understanding of issues relating to public health, civil rights, economics, individual rights, international affairs, liberty, science & technology, etc. We believe this constitutes a 'fair use' of any such copyrighted material as provided for in section 107 of the US Copyright Law. In accordance with Title 17 U.S.C.Section 107, the material on this site is distributed to those who have expressed a prior interest in receiving the included information for research and educational purposes.

In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article. Please remember you are responsible for what you post on the internet and you could be sued by the original copyright holder if you do not honor these rules.

If you are a legal copyright holder or a designated agent for such and you believe a post on this website falls outside the boundaries of "Fair Use" and legitimately infringes on yours or your clients copyright

we may be contacted concerning copyright matters at:

FluTrackers.com Inc.
c/o Sharon Sanders
1676 Hibiscus Avenue
Winter Park, Florida 32789
Phone: 407-406-3037
E-Mail: flutrackers@earthlink.net

In accordance with section 512 of the U.S. Copyright Act our contact information has been registered with the United States Copyright Office. "Safe Harbor" noticing procedures as outlined in the DMCA apply to this website concerning all 3rd party posts published herein.

If notice is given of an alleged copyright violation we will act expeditiously to remove or disable access to the material(s) in question.

All 3rd party material posted on this website is the copyright of the respective owners / authors. FluTrackers.com Inc. makes no claim of copyright on such material.

For more information please visit: http://www.law.cornell.edu/uscode/17/107.shtml

Please be aware any communications sent complaining about a post on this website may be posted publicly at the discretion of the administration.

FluTrackers Does Not Provide Any Medical Advice:

FluTrackers, Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster.

The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website.

By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.

By using and/or accessing this site, either passively or actively, you are agreeing to all of the above conditions. Also, by using and/or accessing this site, either passively or actively, you agree to conduct all business and legal affairs related to this website in the jurisdiction of Flutrackers.com Inc. which is registered in Central Florida, USA.

These Disclaimers are subject to change at anytime.

Email the Webmaster with questions or comments about this site at flutrackers@earthlink.net


All times are GMT -4. The time now is 05:23 PM.