 |
|

June 17th, 2009, 12:50 PM
|
 |
Membro del Comitato Consultivo, Editore e Direttore del Forum Italiano di FluTrackers
|
|
Join Date: Dec 2007
Location: PADUA
Posts: 12,355
|
|
Re: A/Shanghai/71T/2009 acquired E627K
We have to see how epidemic will grow in Hong Kong region before conclude that H1N1 with E627K is more pathogenic than without.
I would like to remember that the pathogenicity determinants we have seen for H5N1 aren't present in novel H1N1 segments; it is also to note that the HA has not developed human-like receptors affinity through known mutations.
In the coming weeks, Hong Kong will enter in the peak seasonal epidemic time, so we will see the rate of new infections, as well as hospitalization and death rate.
Until now, there are not information by HK authorities about severe cases of novel influenza H1N1.
__________________
GIMI69 (IRONOREHOPPER)
--
People come and go, but the creative force of great historical events, as well as important ideas and actions remain. (Aleksandr Romanovic Lurija, 1976)
--
A TIME'S MEMORY (Blog)
ATTRAVERSO QUESTI GIORNI (Blog)
tracciatore_traccia@libero.it
|

June 17th, 2009, 01:22 PM
|
 |
Registered User
|
|
Join Date: Aug 2006
Location: Utah
Posts: 86
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Did I see the word reassortment above? And the 627 reference would be reflected back to:
Quote:
I suspect the swine H1N1 in the southern hemisphere will pick up E627K, either by acquiring a human PB2 via reassortment, or simply through recombination with seasonal flu.
Thus, there will be a...
|
Quote:
|
On the contrary, the fact that all of the California sequences have a Lysine at position 627 of the PB2 segment is fantastic news. Years of research would suggest that the California virus does not...
|
......among many, many others from long periods ago advising, warning, educating.
I am an avid FluTrackers follower and have been somewhat disconcerted with all the various messages that have been circulating on the site. It would seem that there is only one truth about this, and that truth is what we lay people need to know to prepare and especially to know what to really trust for managing our lives.
So, do I understand that the majority has climbed onboard with Dr. Niman?
|

June 17th, 2009, 01:28 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by Mamabird
I have located a number of Swine Flu sequences that have the unique combination in NA of V106I and D247N like that of A/Shanghai/71T and the swine isolates. Interestingly, they are are all, without exception, from Japan. We probably should keep a wary eye out for E627K in the Japan PB2 for all future sequences posted.
|
Asian NA travel log
gb|GQ253504.1| Influenza A virus (A/Shanghai/71T/2009(H1N1)) ... 38.2 0.18
gb|GQ250162.1| Influenza A virus (A/Guangdong/03/2009(H1N1)) ... 38.2 0.18
gb|GQ247727.1| Influenza A virus (A/Moscow/02/2009(H1N1)) seg... 38.2 0.18
gb|GQ232087.1| Influenza A virus (A/Guangdong/02/2009(H1N1)) ... 38.2 0.18
gb|GQ223436.1| Influenza A virus (A/Guangdong/05/2009(H1N1)) ... 38.2 0.18
gb|CY041032.1| Influenza A virus (A/chicken/Laos/37/2008(H5N1... 38.2 0.18
gb|CY041024.1| Influenza A virus (A/chicken/Laos/35/2008(H5N1... 38.2 0.18
gb|CY041016.1| Influenza A virus (A/chicken/Laos/33/2008(H5N1... 38.2 0.18
gb|CY041008.1| Influenza A virus (A/chicken/Laos/17/2008(H5N1... 38.2 0.18
gb|CY040992.1| Influenza A virus (A/chicken/Laos/13/2008(H5N1... 38.2 0.18
dbj|AB470662.1| Influenza A virus (A/duck/Hokkaido/257/2004(H... 38.2 0.18
dbj|AB435523.1| Influenza A virus (A/chicken/Laos/1/2008(H5N1... 38.2 0.18
gb|CY029537.1| Influenza A virus (A/Muscovy duck/Vietnam/1455... 38.2 0.18
dbj|AB355931.1| Influenza A virus (A/duck/Hokkaido/Vac-3/2007... 38.2 0.18
gb|DQ376699.1| Influenza A virus (A/duck/Taiwan/WB29/99(H6N1)... 38.2 0.18
gb|DQ376698.1| Influenza A virus (A/chicken/Taiwan/165/99(H6N... 38.2 0.18
|

June 17th, 2009, 01:33 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Shanghai virus back in 1990
Quote:
Originally Posted by Nancy
In case any one else out there is asking themselves, "what's Shanghai virus?" as I was, here is an OLD (1990) NY Times article about it. If it is irrelevant, feel free to delete.
I don't understand why, if Shanghai virus was a significant problem in the winter of 1989-1990, it wouldn't ALREADY have acquired the ability to spread easily during cold weather?? But you're saying this is new? And is Shanghai currently widespread? More than other strains of seasonal influenza? I'm confused.
Here's the article I found:
http://www.nytimes.com/1990/01/26/us...-epidemic.html
U.S. Health Agency Declares Flu EpidemicBy WILLIAM K. STEVENS
Published: Friday, January 26, 1990
Centers for Disease Control declared yesterday [January 25, 1990] that a nationwide influenza epidemic exists and that it is the most widespread outbreak of the disease since 1984-85.
The flu, predominantly a strain called A-Shanghai, has been identified in every part of the country, and major outbreaks have been found in 35 states, epidemiologists at the centers say.
''We're in an epidemic,'' said Dr. Walter Gunn, a specialist in viral diseases at the centers, in Atlanta.
Based on Death Reports
The epidemic was declared on the basis of reports of deaths from 121 cities around the country. The proportion of deaths caused by influenza and pneumonia, a complication of the flu, was higher than expected for the second consecutive week, meeting the center's definition of an epidemic.
Because there is a lag between the onset of the flu and death and because it takes a week or so to report the deaths, the figures actually reflect the incidence of flu in late December and early January, said Dr. Stephen Ostroff, another epidemiologist at the centers in Atlanta.
Ordinarily, he said, the peak of the flu season comes in the middle to the end of February. This year, he said, ''the surge has come earlier, and we don't know whether it's going to subside early.''
Immunization Still Effective
Dr. Gunn urged flu immunization for people older than 65, those of any age who are in ill health ''and anyone who doesn't want to get the flu.''
Symptoms include a sudden onset of fever, chills, sore throat, headache, muscle aches and pains, general malaise and a dry cough. Dr. Gunn said simple gastrointestinal upset, which seems to have afflicted many in the New York region recently, is probably caused by viruses or infections other than the flu unless the stomach distress is accompanied by other flu symptoms.
When the flu kills people, epidemiologists say, it usually does so through pneumonia, which develops as a secondary infection. But it can also cause death through kidney failure and heart attacks, Dr. Gunn said.
Britain Hit by Same Strain
Dr. Gunn said A-Shanghai flu has been associated with more deaths and more instances of severe complications than other strains.
The A-Shanghai virus has also been responsible for Britain's worst flu epidemic in 14 years. Much of Europe, including the Soviet Union, has also been affected. In Britain last month, the epidemic put so many people in the hospital that London hospitals had to cancel thousands of routine operations and accept only emergency admissions.
In an average year in the United State, Dr. Gunn said, the flu plays a role in at least 20,000 deaths. ''This year we think it's going to be worse,'' he added. ''We don't know how much worse.''
In the outbreak in the winter of 1984-85, 57,400 deaths were attributed to the flu or pneumonia.
Linked to 7.6 Percent of Deaths
Last week, 1,132, or 7.6 percent, of the 15,090 deaths reported to the disease control centers from the 121 cities were attributed to flu or pneumonia. The percentage a week earlier was identical. Usually, the figure is between 6 percent and 6.5 percent for those two weeks, Dr. Ostroff said. Not since the 1984-85 season has that usual level been exceeded by as much as it was in the last two weeks.
The centers said that last week 18 states experienced flu outbreaks considered widespread, with outbreaks in counties accounting for more than half the state's population. Seventeen other states experienced regional outbreaks, with outbreaks in counties accounting for less than half the state population.
The epidemic did not begin in any specific part of the country, Dr. Gunn said. Rather, he said, ''it has been all over the place right from the beginning and has kept enlarging.''
The states reporting widespread outbreaks last week were Connecticut, New York, Massachusetts, Michigan, Wisconsin, Minnesota, Missouri, South Dakota, Nebraska, Virginia, North Carolina, Georgia, Mississippi, Oklahoma, Texas, Montana, Idaho and Arizona.
Those states reporting regional outbreaks were New Hampshire, Pennsylvania, Ohio, Iowa, Delaware, West Virginia, Kentucky, Tennessee, Alabama, Arkansas, Louisiana, Wyoming, Utah, Nevada, Alaska, Washington and New Mexico.
Two other varieties of flu, A-Taiwan and Influenza B, have also been detected in limited outbreaks, the first in Alaska, Arizona, Massachusetts and Iowa, and the second in Virginia and Nebraska, Dr. Gunn said. The symptoms are similar to those of A-Shanghai.
Map of the United States showing the influenza outbreaks by state (NYT)
|
The virus described in the above article has nothing to do with the isolate being discussed on this thread (other than being isolated in Shanghai).
|

June 17th, 2009, 01:39 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by gjs47
Did I see the word reassortment above? And the 627 reference would be reflected back to:
......among many, many others from long periods ago advising, warning, educating.
I am an avid FluTrackers follower and have been somewhat disconcerted with all the various messages that have been circulating on the site. It would seem that there is only one truth about this, and that truth is what we lay people need to know to prepare and especially to know what to really trust for managing our lives.
So, do I understand that the majority has climbed onboard with Dr. Niman?
|
The PB2 is not due to reassortment. It is closley related to the other swine sequences in humans and therefore did not pick a PB2 from a distantly related virus (like human H1N1 or some other mammalian flu with PB2 with E627K).
Some will propose that this is yet another "random mutation" and the match of adjacent sequences with the H7N7 from the dead vet, or the Hong Kong outbreak in 1997 is a yet another "coincidence".
|

June 17th, 2009, 01:44 PM
|
 |
Editor and Director of the Vietnam Forum
|
|
Join Date: May 2006
Posts: 8,933
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by Mamabird
The Shanghai virus has acquired an important characteristic that may affect pathogenicity of Swine Flu.
A/Shanghai/71T/2009, sample acquired on May 31, has Lysine at position 627 of the PB2 segment.
Bears watching, but this is definitely not pleasant news.
|
Thank you Mamabird. Can you tell me when this sample was available to the public for viewing? Was it on May 31st?
|

June 17th, 2009, 01:48 PM
|
|
Resident
|
|
Join Date: Aug 2006
Posts: 670
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by Commonground
Thank you Mamabird. Can you tell me when this sample was available to the public for viewing? Was it on May 31st?
|
Posted to GenBank about a week ago:
June 11, 2009, 56 submitted by JCVI; 16 by Shanghai Public Health Clinical Center Affiliated to Fudan University, China
|

June 17th, 2009, 01:50 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: A/Shanghai/71T/2009 acquired E627K
LOCUS GQ253501 2280 bp cRNA linear VRL 11-JUN-2009
DEFINITION Influenza A virus (A/Shanghai/71T/2009(H1N1)) segment 1 polymerase
PB2 (PB2) gene, complete cds.
ACCESSION GQ253501
VERSION GQ253501.1 GI:239813009
DBLINK Project: 37813
KEYWORDS .
SOURCE Influenza A virus (A/Shanghai/71T/2009(H1N1))
ORGANISM Influenza A virus (A/Shanghai/71T/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2280)
AUTHORS Hu,Y., Song,Z., Tian,D., He,J., Zhou,Z., Zhang,X., Guan,W., Yin,K.,
Wu,M., Chen,Z., Zhang,X., Lu,H., Zhang,Z. and Yuan,Z.
TITLE Genetic Characterization of Swine-Origin 2009 A (H1N1) Influenza
Viruses Isolated in Shanghai
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 2280)
AUTHORS Hu,Y., Song,Z., Tian,D., He,J., Zhou,Z., Zhang,X., Guan,W., Yin,K.,
Wu,M., Chen,Z., Zhang,X., Lu,H., Zhang,Z. and Yuan,Z.
TITLE Direct Submission
JOURNAL Submitted (10-JUN-2009) Research Unit, Shanghai Public Health
Clinical Center Affiliated to Fudan University, Caolang Road 2901,
Shanghai 201508, China
COMMENT GenBank Accession Numbers GQ253497-GQ253504 represent sequences
from the 8 segments of Influenza A virus
(A/Shanghai/71T/2009(H1N1)).
Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
FEATURES Location/Qualifiers
source 1..2280
/organism="Influenza A virus (A/Shanghai/71T/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Shanghai/71T/2009"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon: 651578"
/segment="1"
/country="China"
/collection_date="31-May-2009"
/note="lineage: swl"
gene 1..2280
/gene="PB2"
CDS 1..2280
/gene="PB2"
/codon_start=1
/product="polymerase PB2"
/protein_id=" ACS27790.1"
/db_xref="GI:239813010"
/translation="MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA
LRMKWMMAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPL AVTWWNRN
GPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPGHA DLSAKEAQ
DVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAPLMVAYMLERE LVRKTRFL
PVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVR RAAVSADP
LASLLEMCHSTQIGGVRMVDILRQNPTEEQAVDICKAAIGLRISSSFSFG GFTFKRTS
GSSVKKEEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQL IVSGRDEQ
SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDA KVLFQNWG
IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR FLRVRDQR
GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWE IVKIQWSQ
DPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLFQQMRDVLGTFDTVQII KLLPFAAA
PPKQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNKATKRLTVLGKDAGA LTENPNEG
TSGVESAVLRGFLILGKENKKYGPALSINELSNLAKGEKANVLIGQGDVV LVMKRKRD
SSILTDSQTATKRIRMAIN"
ORIGIN
1 atggagagaa taaaagaact gagagatcta atgtcgcagt cccgcactcg cgagatactc
61 actaagacca ctgtggacca tatggccata atcaaaaagt acacatcagg aaggcaagag
121 aagaaccccg cactcagaat gaagtggatg atggcaatga gatacccaat tacagcagac
181 aagagaataa tggacatgat tccagagagg aatgaacaag gacaaaccct ctggagcaaa
241 acaaacgatg ctggatcaga ccgagtgatg gtatcacctc tggccgtaac atggtggaat
301 aggaatggcc caacaacaag tacagttcat taccctaagg tatataaaac ttatttcgaa
361 aaggtcgaaa ggttgaaaca tggtaccttc ggccctgtcc acttcagaaa tcaagttaaa
421 ataaggagga gagttgatac aaaccctggc catgcagatc tcagtgccaa ggaggcacag
481 gatgtgatta tggaagttgt tttcccaaat gaagtggggg caagaatact gacatcagag
541 tcacagctgg caataacaaa agagaagaaa gaagagctcc aggattgtaa aattgctccc
601 ttgatggtgg cgtacatgct agaaagagaa ttggtccgta aaacaaggtt tctcccagta
661 gccggcggaa caggcagtgt ttatattgaa gtgttgcact taacccaagg gacgtgctgg
721 gagcagatgt acactccagg aggagaagtg agaaatgatg atgttgacca aagtttgatt
781 atcgctgcta gaaacatagt aagaagagca gcagtgtcag cagacccatt agcatctctc
841 ttggaaatgt gccacagcac acagattgga ggagtaagga tggtggacat ccttagacag
901 aatccaactg aggaacaagc cgtagacata tgcaaggcag caatagggtt gaggattagc
961 tcatctttca gttttggtgg gttcactttc aaaaggacaa gcggatcatc agtcaagaaa
1021 gaagaagaag tgctaacggg caacctccaa acactgaaaa taagagtaca tgaagggtat
1081 gaagaattca caatggttgg gagaagagca acagctattc tcagaaaggc aaccaggaga
1141 ttgatccagt tgatagtaag cgggagagac gagcagtcaa ttgctgaggc aataattgtg
1201 gccatggtat tctcacaaga ggattgcatg atcaaggcag ttaggggcga tctgaacttt
1261 gtcaataggg caaaccagcg actgaacccc atgcaccaac tcttgaggca tttccaaaaa
1321 gatgcaaaag tgcttttcca gaactgggga attgaatcca tcgacaatgt gatgggaatg
1381 atcggaatac tgcccgacat gaccccaagc acggagatgt cgctgagagg gataagagtc
1441 agcaaaatgg gagtagatga atactccagc acggagagag tggtagtgag tattgaccga
1501 tttttaaggg ttagagatca aagagggaac gtactattgt ctcccgaaga agtcagtgaa
1561 acgcaaggaa ctgagaagtt gacaataact tattcgtcat caatgatgtg ggagatcaat
1621 ggccctgagt cagtgctagt caacacttat caatggataa tcaggaactg ggaaattgtg
1681 aaaattcaat ggtcacaaga tcccacaatg ttatacaaca aaatggaatt tgaaccattt
1741 cagtctcttg tccctaaggc aaccagaagc cggtacagtg gattcgtaag gacactgttc
1801 cagcaaatgc gggatgtgct tgggacattt gacactgtcc aaataataaa acttctcccc
1861 tttgctgctg ctccaccaaa acagagtagg atgcaatttt cctcattgac tgtgaatgtg
1921 agaggatcag ggttgaggat actggtaaga ggcaattctc cagtattcaa ttacaacaag
1981 gcaaccaaac gacttacagt tcttggaaag gatgcaggtg cattgactga aaatccaaat
2041 gaaggcacat ctggggtgga gtctgctgtc ctgagaggat ttctcatttt gggcaaagaa
2101 aacaagaaat atggcccagc attaagcatc aatgaactga gcaatcttgc aaaaggagag
2161 aaagctaatg tgctaattgg gcaaggggac gtagtgttgg taatgaaacg aaaacgggac
2221 tctagcatac ttactgacag ccagacagcg accaaaagaa ttcggatggc catcaattag
|

June 17th, 2009, 01:53 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by Commonground
Thank you Mamabird. Can you tell me when this sample was available to the public for viewing? Was it on May 31st?
|
Submitted (10-JUN-2009) Research Unit, Shanghai Public Health
Clinical Center Affiliated to Fudan University, Caolang Road 2901,
Shanghai 201508, China
AUTHORS Hu,Y., Song,Z., Tian,D., He,J., Zhou,Z., Zhang,X., Guan,W., Yin,K.,
Wu,M., Chen,Z., Zhang,X., Lu,H., Zhang,Z. and Yuan,Z.
|

June 17th, 2009, 01:58 PM
|
|
Moderator
|
|
Join Date: Apr 2009
Location: wet coast of Canada, eh?
Posts: 361
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by ironorehopper
In the coming weeks, Hong Kong will enter in the peak seasonal epidemic time, so we will see the rate of new infections, as well as hospitalization and death rate.
|
Did you mean 'novel epidemic'? HK is in the northern hemisphere & their seasonal flu activity is surely over....
|

June 17th, 2009, 02:37 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: A/Shanghai/71T/2009 acquired E627K
E627K in swine, etc (including Canadian swine and 1976 swine flu)
gb|GQ229321.1| Influenza A virus (A/swine/Hong Kong/554/2003(... 38.2 0.18
gb|GQ229297.1| Influenza A virus (A/swine/Hong Kong/NS1659/20... 38.2 0.18
gb|GQ253501.1| Influenza A virus (A/Shanghai/71T/2009(H1N1)) ... 38.2 0.18
gb|DQ139325.1| Influenza A virus (A/swine/Zhejiang/1/2004(H1N... 38.2 0.18
gb|GQ229289.1| Influenza A virus (A/swine/Hong Kong/8512/2001... 34.2 2.8
gb|GQ229281.1| Influenza A virus (A/swine/Hong Kong/103/1993(... 34.2 2.8
gb|CY039998.1| Influenza A Virus (A/New Jersey/8/1976(H1N1)) ... 34.2 2.8
gb|CY039932.1| Influenza A Virus (A/swine/Indiana/1726/1988(H... 34.2 2.8
gb|CY039924.1| Influenza A Virus (A/swine/Wisconsin/1915/1988... 34.2 2.8
gb|FJ789824.1| Influenza A virus (A/swine/Shanghai/2/2005(H1N... 34.2 2.8
gb|FJ789830.1| Influenza A virus (A/swine/Shanghai/3/2005(H1N... 34.2 2.8
gb|EU502892.2| Influenza A virus (A/swine/Shanghai/1/2005(H1N... 34.2 2.8
gb|CY036870.1| Influenza A virus (A/swine/Tennessee/107/1977(... 34.2 2.8
gb|CY036806.1| Influenza A virus (A/swine/Wisconsin/30954/197... 34.2 2.8
dbj|AB434413.1| Influenza A virus (A/swine/Saitama/1996(H1N2)... 34.2 2.8
dbj|AB434405.1| Influenza A virus (A/swine/Ehime/1/1980(H1N2)... 34.2 2.8
dbj|AB434397.1| Influenza A virus (A/swine/Niigata/1/1977(H1N... 34.2 2.8
dbj|AB434389.1| Influenza A virus (A/swine/Hokkaido/2/1981(H1... 34.2 2.8
gb|FJ357111.1| Influenza A virus (A/turkey/NC/17026/1988(H1N1... 34.2 2.8
gb|CY035077.1| Influenza A virus (A/swine/Memphis/1/1990(H1N1... 34.2 2.8
gb|EU743158.1| Influenza A virus (A/turkey/IA/10271-3/1990(H1... 34.2 2.8
gb|EU743166.1| Influenza A virus (A/turkey/IA/21089-3/1992(H1... 34.2 2.8
gb|EU743181.1| Influenza A virus (A/chicken/NY/21665-73/1998(... 34.2 2.8
gb|CY032936.1| Influenza A virus (A/swine/Tennessee/109/1977(... 34.2 2.8
gb|EU735793.1| Influenza A virus (A/turkey/NC/19762/1988(H1N1... 34.2 2.8
gb|EU735801.1| Influenza A virus (A/chicken/PA/35154/1991(H1N... 34.2 2.8
gb|EU742643.1| Influenza A virus (A/turkey/KS/4880/1980(H1N1)... 34.2 2.8
gb|CY032220.1| Influenza A virus (A/swine/Wisconsin/1/1961(H1... 34.2 2.8
gb|CY030742.1| Influenza A virus (A/swine/Tennessee/9/1978(H1... 34.2 2.8
gb|CY028787.1| Influenza A virus (A/swine/California/T9001707... 34.2 2.8
gb|CY028795.1| Influenza A virus (A/swine/Iowa/1/1986(H1N1)) ... 34.2 2.8
gb|CY028442.1| Influenza A virus (A/swine/Tennessee/7/1978(H1... 34.2 2.8
gb|CY028434.1| Influenza A virus (A/swine/Tennessee/4/1978(H1... 34.2 2.8
gb|CY028186.1| Influenza A virus (A/swine/Tennessee/3/1978(H1... 34.2 2.8
gb|CY028178.1| Influenza A virus (A/swine/Iowa/2/1987(H1N1)) ... 34.2 2.8
gb|CY027514.1| Influenza A virus (A/swine/Iowa/2/1985(H1N1)) ... 34.2 2.8
gb|CY027530.1| Influenza A virus (A/swine/Tennessee/8/1978(H1... 34.2 2.8
gb|CY027522.1| Influenza A virus (A/swine/Tennessee/5/1978(H1... 34.2 2.8
gb|CY027162.1| Influenza A virus (A/swine/Iowa/24297/1991(H1N... 34.2 2.8
gb|CY027314.1| Influenza A virus (A/swine/Tennessee/2/1978(H1... 34.2 2.8
gb|CY027306.1| Influenza A virus (A/swine/Tennessee/118/1977(... 34.2 2.8
gb|CY026498.1| Influenza A virus (A/swine/Tennessee/112/1977(... 34.2 2.8
gb|CY026490.1| Influenza A virus (A/swine/Tennessee/106/1977(... 34.2 2.8
gb|CY026482.1| Influenza A virus (A/swine/Tennessee/105/1977(... 34.2 2.8
gb|CY026474.1| Influenza A virus (A/swine/Iowa/100/1977(H1N1)... 34.2 2.8
gb|CY026466.1| Influenza A virus (A/swine/Tennessee/10/1976(H... 34.2 2.8
gb|CY026458.1| Influenza A virus (A/swine/Ontario/6/1981(H1N1... 34.2 2.8
gb|CY026450.1| Influenza A virus (A/swine/Ontario/3/1981(H1N1... 34.2 2.8
gb|CY026442.1| Influenza A virus (A/swine/Ontario/2/1981(H1N1... 34.2 2.8
gb|CY026426.1| Influenza A virus (A/swine/Tennessee/23/1976(H... 34.2 2.8
gb|CY026306.1| Influenza A virus (A/swine/Wisconsin/2/1966(H1... 34.2 2.8
gb|CY026298.1| Influenza A virus (A/swine/Wisconsin/1/1967(H1... 34.2 2.8
gb|CY026290.1| Influenza A virus (A/swine/Wisconsin/1/1957(H1... 34.2 2.8
gb|CY026146.1| Influenza A virus (A/Wisconsin/301/1976(H1N1))... 34.2 2.8
gb|CY025212.1| Influenza A virus (A/swine/Tennessee/37/1977(H... 34.2 2.8
gb|CY025017.1| Influenza A virus (A/swine/Kansas/3024/1987(H1... 34.2 2.8
gb|CY025064.1| Influenza A virus (A/swine/Tennessee/48/1977(H... 34.2 2.8
gb|CY024932.1| Influenza A virus (A/Ohio/3559/1988(H1N1)) seg... 34.2 2.8
gb|CY025009.1| Influenza A virus (A/swine/Arizona/148/1977(H1... 34.2 2.8
gb|CY025001.1| Influenza A virus (A/swine/Wisconsin/663/1980(... 34.2 2.8
gb|CY024993.1| Influenza A virus (A/swine/Tennessee/10/1978(H... 34.2 2.8
gb|CY024985.1| Influenza A virus (A/swine/Tennessee/88/1977(H... 34.2 2.8
gb|CY024977.1| Influenza A virus (A/swine/Tennessee/87/1977(H... 34.2 2.8
gb|CY024969.1| Influenza A virus (A/swine/Tennessee/86/1977(H... 34.2 2.8
gb|CY024961.1| Influenza A virus (A/swine/Tennessee/84/1977(H... 34.2 2.8
gb|CY025068.1| Influenza A virus (A/swine/Tennessee/96/1977(H... 34.2 2.8
gb|CY024940.1| Influenza A virus (A/swine/Minnesota/24/1975(H... 34.2 2.8
gb|CY022977.1| Influenza A virus (A/swine/Iowa/31483/1988(H1N... 34.2 2.8
gb|CY023001.1| Influenza A virus (A/swine/Wisconsin/629/1980(... 34.2 2.8
gb|CY022985.1| Influenza A virus (A/swine/Ontario/1/1981(H1N1... 34.2 2.8
gb|CY022961.1| Influenza A virus (A/swine/Iowa/1/1977(H1N1)) ... 34.2 2.8
gb|CY022324.1| Influenza A virus (A/swine/Iowa/1/1985(H1N1)) ... 34.2 2.8
gb|CY022332.1| Influenza A virus (A/swine/Iowa/3/1985(H1N1)) ... 34.2 2.8
gb|CY022340.1| Influenza A virus (A/swine/Iowa/17672/1988(H1N... 34.2 2.8
gb|CY022436.1| Influenza A virus (A/swine/Wisconsin/1915/1988... 34.2 2.8
gb|CY022476.1| Influenza A virus (A/swine/Kansas/3228/1987(H1... 34.2 2.8
gb|CY022484.1| Influenza A virus (A/swine/Maryland/23239/1991... 34.2 2.8
gb|CY022468.1| Influenza A virus (A/swine/Wisconsin/8/1980(H1... 34.2 2.8
gb|CY022460.1| Influenza A virus (A/swine/Wisconsin/661/1980(... 34.2 2.8
gb|CY022452.1| Influenza A virus (A/swine/Wisconsin/641/1980(... 34.2 2.8
gb|CY022444.1| Influenza A virus (A/swine/Wisconsin/2/1970(H1... 34.2 2.8
gb|CY022428.1| Influenza A virus (A/swine/Wisconsin/11/1980(H... 34.2 2.8
gb|CY022420.1| Influenza A virus (A/swine/Wisconsin/1/1971(H1... 34.2 2.8
gb|CY022412.1| Influenza A virus (A/swine/Tennessee/11/1978(H... 34.2 2.8
gb|CY022404.1| Influenza A virus (A/swine/Tennessee/1/1975(H1... 34.2 2.8
gb|CY022396.1| Influenza A virus (A/swine/Ontario/7/1981(H1N1... 34.2 2.8
gb|CY022388.1| Influenza A virus (A/swine/Ontario/4/1981(H1N1... 34.2 2.8
gb|CY022380.1| Influenza A virus (A/swine/Nebraska/123/1977(H... 34.2 2.8
gb|CY022372.1| Influenza A virus (A/swine/Minnesota/5892-7/19... 34.2 2.8
gb|CY022364.1| Influenza A virus (A/swine/Minnesota/27/1976(H... 34.2 2.8
gb|CY022356.1| Influenza A virus (A/swine/Kentucky/1/1976(H1N... 34.2 2.8
gb|CY022348.1| Influenza A virus (A/swine/Illinois/1/1975(H1N... 34.2 2.8
gb|CY022308.1| Influenza A virus (A/swine/Tennessee/82/1977(H... 34.2 2.8
gb|CY022292.1| Influenza A virus (A/swine/Tennessee/65/1977(H... 34.2 2.8
gb|CY022276.1| Influenza A virus (A/swine/Tennessee/10/1977(H... 34.2 2.8
gb|CY022148.1| Influenza A virus (A/swine/Tennessee/64/1977(H... 34.2 2.8
gb|CY022140.1| Influenza A virus (A/swine/Tennessee/49/1977(H... 34.2 2.8
gb|CY022132.1| Influenza A virus (A/swine/Tennessee/31/1977(H... 34.2 2.8
gb|CY022124.1| Influenza A virus (A/swine/Tennessee/21/1977(H... 34.2 2.8
gb|CY022116.1| Influenza A virus (A/swine/Tennessee/19/1977(H... 34.2 2.8
gb|CY022108.1| Influenza A virus (A/swine/Iowa/4/1976(H1N1)) ... 34.2 2.8
gb|CY022068.1| Influenza A virus (A/swine/Tennessee/19/1976(H... 34.2 2.8
gb|CY022076.1| Influenza A virus (A/swine/Iowa/1/1976(H1N1)) ... 34.2 2.8
gb|CY022060.1| Influenza A virus (A/swine/Tennessee/17/1976(H... 34.2 2.8
gb|CY022052.1| Influenza A virus (A/swine/Tennessee/15/1976(H... 34.2 2.8
gb|CY022044.1| Influenza A virus (A/swine/Tennessee/7/1976(H1... 34.2 2.8
gb|CY022036.1| Influenza A virus (A/swine/Tennessee/3/1976(H1... 34.2 2.8
gb|CY017306.1| Influenza A virus (A/New York/701/1995(H3N2)) ... 34.2 2.8
gb|CY013326.1| Influenza A virus (A/New York/676/1995(H3N2)) ... 34.2 2.8
gb|CY013318.1| Influenza A virus (A/New York/660/1995(H3N2)) ... 34.2 2.8
gb|CY012935.1| Influenza A virus (A/New York/699/1995(H3N2)) ... 34.2 2.8
gb|CY012527.1| Influenza A virus (A/New York/700/1995(H3N2)) ... 34.2 2.8
gb|CY012511.1| Influenza A virus (A/New York/678/1995(H3N2)) ... 34.2 2.8
gb|CY012503.1| Influenza A virus (A/New York/668/1995(H3N2)) ... 34.2 2.8
gb|CY011847.1| Influenza A virus (A/New York/687/1995(H3N2)) ... 34.2 2.8
gb|CY011559.1| Influenza A virus (A/New York/674/1995(H3N2)) ... 34.2 2.8
gb|CY011543.1| Influenza A virus (A/New York/671/1995(H3N2)) ... 34.2 2.8
gb|CY011519.1| Influenza A virus (A/New York/662/1995(H3N2)) ... 34.2 2.8
gb|CY011375.1| Influenza A virus (A/New York/703/1995(H3N2)) ... 34.2 2.8
gb|CY011327.1| Influenza A virus (A/New York/692/1995(H3N2)) ... 34.2 2.8
gb|CY009923.1| Influenza A virus (A/swine/Tennessee/25/1977(H... 34.2 2.8
gb|DQ280245.1| Influenza A virus (A/swine/Ontario/11112/04(H1... 34.2 2.8
gb|DQ280237.1| Influenza A virus (A/swine/Ontario/23866/04(H1... 34.2 2.8
gb|DQ280229.1| Influenza A virus (A/swine/Ontario/48235/04(H1... 34.2 2.8
gb|DQ280205.1| Influenza A virus (A/swine/Ontario/55383/04(H1... 34.2 2.8
gb|DQ280197.1| Influenza A virus (A/swine/Alberta/56626/03(H1... 34.2 2.8
gb|DQ280189.1| Influenza A virus (A/swine/Ontario/57561/03(H1... 34.2 2.8
gb|CY002279.1| Influenza A virus (A/Memphis/24/95(H3N2)) segm... 34.2 2.8
gb|AF037413.1|AF037413 Influenza A virus H3N2 A/Tochigi/44/95... 34.2 2.8
gb|U71133.1|IAU71133 Influenza A virus H3N2 A/Akita/1/95 PB2 ... 34.2 2.8
gb|M73513.1|FLAH1N1P2A Influenza A virus (A/swine/Tennessee/2... 34.2 2.8
|

June 17th, 2009, 03:33 PM
|
 |
Membro del Comitato Consultivo, Editore e Direttore del Forum Italiano di FluTrackers
|
|
Join Date: Dec 2007
Location: PADUA
Posts: 12,355
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by hornblower
Did you mean 'novel epidemic'? HK is in the northern hemisphere & their seasonal flu activity is surely over....
|
Hong Kong has two annual flu peaks: one during the winter (december to february, march) and one in the mid of summer (July, August).
This pattern could be common to other region with a similar climate or geographic location (ie: tropical regions)
__________________
GIMI69 (IRONOREHOPPER)
--
People come and go, but the creative force of great historical events, as well as important ideas and actions remain. (Aleksandr Romanovic Lurija, 1976)
--
A TIME'S MEMORY (Blog)
ATTRAVERSO QUESTI GIORNI (Blog)
tracciatore_traccia@libero.it
|

June 17th, 2009, 03:33 PM
|
 |
Registered User
|
|
Join Date: Feb 2006
Location: germany
Posts: 8,620
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by hornblower
Did you mean 'novel epidemic'? HK is in the northern hemisphere & their seasonal flu activity is surely over....
|
HK usually has 2 seasonal waves per season
|

June 18th, 2009, 02:20 AM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: A/Shanghai/71T/2009 acquired E627K
2007 Airport passenger traffic:
Shanghai Pudong International Airport, 28,920,432
Shanghai Hongqiao International Airport, 22,632,962
That's over 60 million opportunities for the flu to hitch a ride to elsewhere.
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|

June 18th, 2009, 02:30 AM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: A/Shanghai/71T/2009 acquired E627K
It took only 46 days (since 1st diagnosed atypical pneumonia in Oaxaca) to acquire this change, although we should assume there were earlier undiagnosed cases.
Amazing.
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|

June 18th, 2009, 02:43 AM
|
 |
Registered User
|
|
Join Date: Feb 2006
Location: germany
Posts: 8,620
|
|
Re: A/Shanghai/71T/2009 acquired E627K
the fact that we have possible reassortment and E627K
in the same virus together with the other 4 mutations
close to 627 in PB2 lets me assume that it's somehow
a lab error.
Or an immunodeficient patient.
Or extensive growth of viruses over several generations.
So many A-nucleotides
So many mutations in total, i.e. Shanghai/37T
Why the T in the name ?
we sometimes see such things with nearby mutations,
I tend to ignore them, they look like errors.
e.g. these Paris-isolates Paris/2590 , Paris/2592 ,...
1059,1062,1080,1317,1329,1330 in NA - what is it ?
Norway/1168,1177 156,159,162 in PB1
Italy/02 in NP
Mexico/47N in NA
Shanghai/37T in NA
|

June 18th, 2009, 02:47 AM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Why would an immunodeficient patient's infection have a different set of genes? (sources please)
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|

June 18th, 2009, 03:33 AM
|
 |
Registered User
|
|
Join Date: Feb 2006
Location: germany
Posts: 8,620
|
|
Re: A/Shanghai/71T/2009 acquired E627K
not different genes, but prolonged infection and more mutations.
Imagine one virus infecting a human, then after 2 days a mutation
occurs and spreads inside the human as well as the original virus.
After 4 days it transmits to another person, how likely is it that
that 2nd person gets the mutation ?
(answer:remote)
When you wait 2 weeks, however then the level of the original virus
and the mutated one in the body should be almost 50%:50%
several examples of immunodefient people with influenza here at FT,
I remember I once even sent you a link by PM
maybe I can search direct links later, if there is still demand...
|

June 18th, 2009, 03:35 AM
|
 |
Registered User
|
|
Join Date: Feb 2006
Location: germany
Posts: 8,620
|
|
Re: A/Shanghai/71T/2009 acquired E627K
|

June 18th, 2009, 03:43 AM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by gsgs
not different genes, but prolonged infection and more mutations.
Imagine one virus infecting a human, then after 2 days a mutation
occurs and spreads inside the human as well as the original virus.
After 4 days it transmits to another person, how likely is it that
that 2nd person gets the mutation ?
(answer:remote)
When you wait 2 weeks, however then the level of the original virus
and the mutated one in the body should be almost 50%:50%
several examples of immunodefient people with influenza here at FT,
I remember I once even sent you a link by PM
maybe I can search direct links later, if there is still demand...
|
So you're referring to Dr. Webster's "superspreader" outcome in H5N1-infected HIV patients? If so, now I understand what you mean. As I remember, there wasn't a firm conclusion.
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|

June 18th, 2009, 04:14 AM
|
 |
Registered User
|
|
Join Date: Feb 2006
Location: germany
Posts: 8,620
|
|
Re: A/Shanghai/71T/2009 acquired E627K
immunodeficient child with prolonged infection:
http://www.flutrackers.com/forum/showthread.php?t=13292
> It is likely to be practical to produce immunodeficient pigs since pigs can be bred and raised
> in germ-free environments (eg: Gnotobiotic pigs J Virol (1998) 72,:330-338).
these could be suitable to produce new dangerous flu-strains ?!
and may explain the many mutations and secrecy with the Alberta-pigs ?
------edit--------------------------
another source (although old) :
http://jvi.asm.org/cgi/reprint/65/5/2340
.0058-.017 mutations per nucleotide-position in HA per year (~.004 are normal)
.0035-.024 mutations per nucleotide position in NP per year (~.003 are normal)
|

June 18th, 2009, 04:41 AM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by gsgs
|
Yes, FT ancient history......good reading.
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|

June 18th, 2009, 06:50 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: A/Shanghai/71T/2009 acquired E627K
|

June 18th, 2009, 06:53 AM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by niman
|
Commentary
E627K Acquisition in Swine H1N1 Raises Pandemic Concerns
Recombinomics Commentary 11:37
June 18, 2009
The recently released PB2 sequence from a patient in Shanghai (see Maps) contains E627K. This is the first reported acquisition of this change, which is present in virtually all human influenza A isolates, including the pandemic strain from 1918.
The current isolate, A/Shanghai/71T/2009, was collected May 31, 2009 and the sequence was deposited at Genbank on June 10, 2009. The isolate is closely related to the swine H1N1 currently spreading worldwide, and all positions upstream from E627K match the consensus sequence, indicating the E627K was not acquired through reassortment with human PB2 or other H1N1 viruses that were not closely related to the swine H1N1 circulating in the human population.
Acquisition of E627K is a concern because it allows for optimal replication at 33 C, the temperature of a human nose in the winter, in contrast to E627, which is in the avian version of PB2 and allows for optimal replication at 41 C, the body temperature of birds. The PB2 in the swine is of avian origin, and A/Shanghi/71T/2009 is the first public sequence from the circulating sub-clade with E627K.
In human seasonal flu, activity peaks in the winter months and only minimal levels are detected in humans over the summer. However, the swine flu has remained active and almost all influenza A detected in the northern hemisphere at this time is swine flu.
The appearance of E627K raises concerns that the level of swine flu with E627K will markedly increase in colder months. In 1918, the flu in the spring was mild, but the fall version of the virus, which had E627K, was much more virulent and targeted young, previously healthy adults, as previously reported for the outbreak in Mexico, and now being reported in United States and Canada, where levels are highest, as well as other countries worldwide.
Although the current case fatality rate is low, small changes like E627K could increase viral load, leading to high cytokine levels, which are associated with many of the deaths due to the current "milder" version of the swine H1N1. In contrast to the recent isolate from Brazil, A/Sao Paulo/1454/2009 which is identical to the HA consensus sequence, the A/Shanghai/71T/2009 has a unique change that is not found in closely related sequences.
This change is found in other H1N1 swine sequences (see list here) and the region surrounding E627K matches H3N2 seasonal flu in circulation in 1995. Moreover, the downstream region matches sequences found in human lethal infections in the H7N7 outbreak in the Netherlands in 2003, as well as the H5N1 outbreak in Hong Kong in 1997 (see matches here). However, in the above outbreaks transmission to humans was not efficient and the number of deaths was limited. The only reported death in the H7N7 outbreak was a veterinarian infected with nH7N7 containing E627K (and that case remains the only example of a human fatal bird flu infection not involving H5N1). The H5N1 sequence from Hong Kong was used to show the association of E627K with increased virulence in mice.
Thus, the acquisition of PB2 E627K in the swine H1N1 is readily explain by homologous recombination with locally related sequences containing E627K, which was a concern when the swine H1N1 began transmitting efficiently in humans . This sustained efficient transmission lead to a phase 6 designation for the 2009 pandemic and the acquisition of E627K creates concern that the virus will evolve into a more lethal agent that will be associated with an increased case fatality rate with previously healthy young adults, as was seen in the 1918 pandemic.
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|

June 18th, 2009, 07:45 AM
|
|
Retired
|
|
Join Date: Aug 2008
Posts: 411
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by AlaskaDenise
Acquisition of E627K is a concern because it allows for optimal replication at 33 C, the temperature of a human nose in the winter, in contrast to E627, which is in the avian version of PB2 and allows for optimal replication at 41 C, the body temperature of birds.
|
Niman, Mama, GS and all the rest of you who understand the science behind all of this - THANK YOU for all of the clarifications and laymen speak. I have followed the "scientific level" discussions of this sort for years - and often my mind just goes poof! But it is very comforting to know that we have people such as yourselves that add legitimacy to the site, and help the rest of us begin to grasp all the complex science of things. It is so helpful to the rest of us to occassionally have these little "Easily Worded Summaries for the Ignorant Laymen"  Thank You all.
|

June 18th, 2009, 08:00 AM
|
 |
Moderator
|
|
Join Date: Jun 2006
Posts: 813
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by The Mountains Voice
Niman, Mama, GS and all the rest of you who understand the science behind all of this - THANK YOU for all of the clarifications and laymen speak. I have followed the "scientific level" discussions of this sort for years - and often my mind just goes poof! But it is very comforting to know that we have people such as yourselves that add legitimacy to the site, and help the rest of us begin to grasp all the complex science of things. It is so helpful to the rest of us to occassionally have these little "Easily Worded Summaries for the Ignorant Laymen"  Thank You all.
|
Well stated Mountains Voice. I ditto that comment!
__________________
"There's a chance peace will come in your life - please buy one" - Melanie Safka
"The greatest way to live with honor in this world is to be what we pretend to be" - Socrates
|

June 18th, 2009, 08:35 AM
|
 |
Registered User
|
|
Join Date: Feb 2006
Location: germany
Posts: 8,620
|
|
Re: A/Shanghai/71T/2009 acquired E627K
all what the laymen need are expert probability estimates and
damage expectation values.
The discussion is being done to improve these estimates.
|

June 18th, 2009, 08:38 AM
|
 |
Registered User
|
|
Join Date: Feb 2006
Location: germany
Posts: 8,620
|
|
Re: A/Shanghai/71T/2009 acquired E627K
they isolate these sequences, upload to genbank, but give no
comments on the mutation, not even location,age, travel history,
how they grew it etc.
do I see a new strategy of secrecy here ?
sequences are being uploaded, even all 8 segments from China,
but circumstances and details remain secret.
|

June 18th, 2009, 10:06 AM
|
|
Resident
|
|
Join Date: Aug 2006
Posts: 670
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by gsgs
the fact that we have possible reassortment and E627K
in the same virus together with the other 4 mutations
close to 627 in PB2 lets me assume that it's somehow
a lab error.
|
A second A/Shanghai/71T sequence has been posted to GISAID, this time with c2 passage. Same result. Lab error beginning to seem less likely. Lets continue to keep a lookout for other isolates with this nasty change.
|

June 18th, 2009, 10:23 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: A/Shanghai/71T/2009 acquired E627K
Quote:
Originally Posted by gsgs
all what the laymen need are expert probability estimates and
damage expectation values.
The discussion is being done to improve these estimates.
|
Speaking of probability estimates, do you still think that there is a 20% chance that the 2009 Pandemic isn't a pandemic?????
|
 |
|
|
Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
|
|
|
| Thread Tools |
Search this Thread |
|
|
|
| Display Modes |
Linear Mode
|
Posting Rules
|
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts
HTML code is On
|
|
|
Disclaimer:
The reader is responsible for discerning the validity, factuality or implications of information posted here, be it fictional or based on real events. Moderators on this forum make every effort to review the material posted on this site however, it is not realistically possible for our staff to manually review each post.
The content of posts on this site, including but not limited to links to other web sites, are the expressed opinion of the original authors or posters and are not endorsed by, or representative of the opinions of, the owners or administration of this website. The posts on this website are the opinion of the specific author or poster and should not be construed as statements of advice or factual information.
Not all posts on this website are intended as truthful or factual assertion by their authors. NO posts on this website should be considered factual information on face value alone. Users are encouraged to USE DISCERNMENT and do their own follow up research while reading and posting on this website. FluTrackers.com Inc. reserves the right to make changes to, corrections and/or remove entirely at any time posts made on this website without notice. In addition, FluTrackers.com Inc. disclaims any and all liability for damages incurred directly or indirectly as a result of a post on this website.
This site is provided "as is" without warranty of any kind, either expressed or implied. You should not assume that this site is error-free or that it will be suitable for the particular purpose which you have in mind when using it. In no event shall FluTrackers.com Inc. be liable for any special, incidental, indirect or consequential damages of any kind, or any damages whatsoever, including, without limitation, those resulting from loss of use, data or profits, whether or not advised of the possibility of damage, and on any theory of liability, arising out of or in connection with the use or performance of this site or other documents which are referenced by or linked to this site.
Finally, FluTrackers.com Inc. reserves the right to delete, correct, or make changes to any post on this website without notice at any time for any reason.
Fair Use Notice:
This site may contain copyrighted material the use of which has not always been specifically authorized by the copyright owner. Users may make such material available in an effort to advance awareness and understanding of issues relating to public health, civil rights, economics, individual rights, international affairs, liberty, science & technology, etc. We believe this constitutes a 'fair use' of any such copyrighted material as provided for in section 107 of the US Copyright Law. In accordance with Title 17 U.S.C.Section 107, the material on this site is distributed to those who have expressed a prior interest in receiving the included information for research and educational purposes.
In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article. Please remember you are responsible for what you post on the internet and you could be sued by the original copyright holder if you do not honor these rules.
If you are a legal copyright holder or a designated agent for such and you believe a post on this website falls outside the boundaries of "Fair Use" and legitimately infringes on yours or your clients copyright
we may be contacted concerning copyright matters at:
FluTrackers.com Inc.
c/o Sharon Sanders
1676 Hibiscus Avenue
Winter Park, Florida 32789
Phone: 407-406-3037
E-Mail: flutrackers@earthlink.net
In accordance with section 512 of the U.S. Copyright Act our contact information has been registered with the United States Copyright Office. "Safe Harbor" noticing procedures as outlined in the DMCA apply to this website concerning all 3rd party posts published herein.
If notice is given of an alleged copyright violation we will act expeditiously to remove or disable access to the material(s) in question.
All 3rd party material posted on this website is the copyright of the respective owners / authors. FluTrackers.com Inc. makes no claim of copyright on such material.
For more information please visit:
http://www.law.cornell.edu/uscode/17/107.shtml
Please be aware any communications sent complaining about a post on this website may be posted publicly at the discretion of the administration.
FluTrackers Does Not Provide Any Medical Advice:
FluTrackers, Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster.
The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website.
By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
By using and/or accessing this site, either passively or actively, you are agreeing to all of the above conditions. Also, by using and/or accessing this site, either passively or actively, you agree to conduct all business and legal affairs related to this website in the jurisdiction of Flutrackers.com Inc. which is registered in Central Florida, USA.
These Disclaimers are subject to change at anytime.
Email the Webmaster with questions or comments about this site at flutrackers@earthlink.net
All times are GMT -4. The time now is 05:29 PM.
|