medpedia.com FluTrackers

Tracking Infectious Diseases since 2006

FluTrackers.com Inc. is a 501(c)(3) charity

Official PayPal Seal
H1N1 Swine Flu Information Información Gripe H1N1 Information Grippe H1N1 Influenza H1N1 Informazioni FluTrackers Latest Posts

www www.flutrackers.com



Go Back   FluTrackers > Welcome to the SCIENTIFIC LIBRARY > Anti-Virals and Anti-Viral Resistance

Reply
 
Thread Tools Search this Thread Display Modes
  #1  
Old July 3rd, 2009, 05:30 AM
ironorehopper's Avatar
ironorehopper ironorehopper is online now
Membro del Comitato Consultivo, Editore e Direttore del Forum Italiano di FluTrackers
 
Join Date: Dec 2007
Location: PADUA
Posts: 12,355
Exclamation Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

A spokesman for the Department of Health (DH) said the department's Public Health Laboratory Services Branch (PHLSB) today (July 3) detected a strain of human swine influenza (HSI) virus which was resistant to oseltamivir (Tamiflu).


The virus was identified during PHLSB's routine sensitivity test of HSI virus to oseltamivir and zanamivir, the spokesman said.

"This is the first time Tamiflu resistance in HSI virus found in Hong Kong," he said, adding that similar cases were also reported in Denmark and possibly Japan.

"Tests showed that this strain is sensitive to zanamivir (Relenza)," he said.


The virus was isolated from the specimen taken from a 16-year-old girl coming from San Francisco. She was intercepted by Port Health Office at the Hong Kong International Airport on June 11 upon arrival. The girl was then admitted to Queen Mary Hospital for isolation. She was tested positive to HSI but opted not to take tamiflu. She had mild symptoms and was eventually discharged upon recovery on June 18.

The spokesman noted that PHLSB conducted routine sensitivity tests on specimens taken from confirmed HSI patients.

"This is the only Tamiflu-resistant strain so far among some 200 HSI samples tested in Hong Kong. Further tests are underway," he said.

Hong Kong has maintained an antiviral stockpile of both Tamiflu and Relenza.

The case will be reported to the World Health Organization (WHO), the spokesman said. He reiterated that Hong Kong had an intensive influenza surveillance system on antiviral resistant influenza viruses.

"We will closely liaise with WHO and overseas health authorities and monitor the global development of antiviral resistant HSI virus," he said.
-

View Original Article
__________________
GIMI69 (IRONOREHOPPER)
--

People come and go, but the creative force of great historical events, as well as important ideas and actions remain. (Aleksandr Romanovic Lurija, 1976)
--
A TIME'S MEMORY (Blog)
ATTRAVERSO QUESTI GIORNI (Blog)
tracciatore_traccia@libero.it
Reply With Quote
  #2  
Old July 3rd, 2009, 06:48 AM
Snicklefritz's Avatar
Snicklefritz Snicklefritz is offline
Senior Moderator
 
Join Date: Jun 2006
Posts: 429
Default Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Quote:
The virus was isolated from the specimen taken from a 16-year-old girl coming from San Francisco. She was intercepted by Port Health Office at the Hong Kong International Airport on June 11 upon arrival. The girl was then admitted to Queen Mary Hospital for isolation. She was tested positive to HSI but opted not to take tamiflu. She had mild symptoms and was eventually discharged upon recovery on June 18.
Any questions?
Reply With Quote
  #3  
Old July 3rd, 2009, 06:56 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Breaking First Tamiflu-resistant swine flu case found in teenager (Hong Kong ex San Francisco)

First Tamiflu-resistant swine flu case found in teenager
(10 mins ago)
A 16-year-old girl was found to be infected with a mutation of the swine flu virus that is resistant to the antiviral Tamiflu soon after arriving from San Francisco, the Department of Health said today.

It is the first such case in Hong Kong. Similar cases have been reported in Denmark and Japan.

The teenager was intercepted at the airport on June 11 and admitted to Queen Mary Hospital.

She opted not to be put on a course of Tamiflu before testing positive for the swine flu strain, which is known to be resistant to the antiviral.

She had mild symptoms and was discharged on June 18.

The case will be reported to the World Health Organization.

Danish health authorities have used Relenza, an alternative anti-flu medication, to successfully treat a female patient with the same strain.

The Japanese said a patient was found to be resistant to Tamiflu after being put on the drug since she was being diagnosed with the H1N1 virus around two weeks ago, Kyodo news agency reported yesterday.

The Osaka prefecture patient was recovering after having been given Relenza.

A spokeswoman for Swiss pharmaceuticals giant Roche, which makes Tamiflu, said the company had been informed of the case and described as ''normal'' such resistance to the drug.

''It is absolutely normal,'' she said, adding that ''0.4 percent of adults develop resistance'' to Tamiflu.

She said such cases do not indicate Tamiflu has become less effective against swine flu.

http://www.thestandard.com.hk/breaki...l.asp?id=15461
Reply With Quote
  #4  
Old July 3rd, 2009, 07:00 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: First Tamiflu-resistant swine flu case found in teenager (Hong Kong ex San Francisco)

NO indication that this case was Tamiflu treated.
Reply With Quote
  #5  
Old July 3rd, 2009, 07:08 AM
Dutchy's Avatar
Dutchy Dutchy is offline
Editor, Senior Moderator
 
Join Date: Aug 2006
Location: Netherlands
Posts: 10,613
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Coming from USA .
Reply With Quote
  #6  
Old July 3rd, 2009, 07:12 AM
Commonground's Avatar
Commonground Commonground is offline
Editor and Director of the Vietnam Forum
 
Join Date: May 2006
Posts: 8,933
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

discovered during routine testing

Quote:
The spokesman noted that PHLSB conducted routine sensitivity tests on specimens taken from confirmed HSI patients.
__________________
My Blog: http://pandemicinformationnews.blogspot.com/
Reply With Quote
  #7  
Old July 3rd, 2009, 07:12 AM
the doctor the doctor is offline
Resident
 
Join Date: Dec 2006
Location: Decatur, GA
Posts: 470
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

So the 274 was fit as a fiddle and contracted in the good ole USA.

GW
__________________
The Doctor
Reply With Quote
  #8  
Old July 3rd, 2009, 07:25 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Quote:
Originally Posted by the doctor View Post
So the 274 was fit as a fiddle and contracted in the good ole USA.

GW
Exactly right.

H274Y - NO tamiflu required.
Reply With Quote
  #9  
Old July 3rd, 2009, 08:47 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Commentary
Reply With Quote
  #10  
Old July 3rd, 2009, 09:01 AM
St Michael's Avatar
St Michael St Michael is offline
Senior User
 
Join Date: Jun 2006
Posts: 602
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Quote:
Originally Posted by niman View Post
Thanks Dr. Niman:

Quote:
Commentary


Recombinomics Commentary 13:36
July 3, 2009

The virus was identified during PHLSB's routine sensitivity test of HSI virus to oseltamivir and zanamivir, the spokesman said.

"This is the first time Tamiflu resistance in HSI virus found in Hong Kong," he said, adding that similar cases were also reported in Denmark and possibly Japan.

"Tests showed that this strain is sensitive to zanamivir (Relenza)," he said.

The virus was isolated from the specimen taken from a 16-year-old girl coming from San Francisco. She was intercepted by Port Health Office at the Hong Kong International Airport on June 11 upon arrival. The girl was then admitted to Queen Mary Hospital for isolation. She was tested positive to HSI but opted not to take tamiflu. She had mild symptoms and was eventually discharged upon recovery on June 18.

The spokesman noted that PHLSB conducted routine sensitivity tests on specimens taken from confirmed HSI patients.


The above comments from the Hong Kong Department of Health press release describe Tamiflu resistance (presumably H274Y, aka H275Y) in a patient arriving from San Francisco. The resistance was discovered during routine surveillance and there is no indication the patient was taking oseltamivir, indicating the pandemic H1N1 was evolutionarily fit.

The two other cases described this were (in Denmark and Japan) were in patients under prophylactic treat of Tamiflu. In both cases the resistance was due to H274Y (and discovered because of the prophylactic treatment).

Evolutionarily fit swine flu with H274Y is cause for concern. Last year seasonal H1N1 with H274Y spread worldwide. It had previous spread from one genetic background to another via genetic hitchhiking and recombination.

It is likely that H274Y in pandemic H1N1 will now follow a similar, but accelerated, pathway due to widespread use of oseltamivir to control the spread of pandemic H1N1.

The export of H274Y from San Francisco, and failure to identify the polymorphism in the United States, raises serious surveillance concerns.
Reply With Quote
  #11  
Old July 3rd, 2009, 09:34 AM
Snicklefritz's Avatar
Snicklefritz Snicklefritz is offline
Senior Moderator
 
Join Date: Jun 2006
Posts: 429
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Reply With Quote
  #12  
Old July 3rd, 2009, 10:33 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Commentary
Reply With Quote
  #13  
Old July 3rd, 2009, 10:44 AM
sharon sanders's Avatar
sharon sanders sharon sanders is online now
Editor-in-Chief & President
 
Join Date: Feb 2006
Posts: 16,778
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Tamiflu resistance in Swine flu in Denmark -

http://www.flutrackers.com/forum/sho...d.php?t=113101


Tamiflu resistance in Swine flu in Japan

http://www.flutrackers.com/forum/sho...d.php?t=113750
__________________
"May the long time sun
Shine upon you,
All love surround you,
And the pure light within you
Guide your way on."

"Where your talents and the needs of the world cross, lies your calling."
Aristotle

“In a gentle way, you can shake the world.”
Mohandas Gandhi

Be the light that is within.
Reply With Quote
  #14  
Old July 3rd, 2009, 11:16 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Hong Kong finds 1st case of Tamiflu-resistant H1N1

Fri Jul 3, 2009 8:39am EDT



HONG KONG (Reuters) - Hong Kong's health department said on Friday it had detected a case of human swine influenza virus that was resistant to Tamiflu, the main antiviral flu drug.
The World Health Organization has declared a pandemic is under way from the new H1N1 virus, also known as swine flu.
"This is the first time Tamiflu resistance in HSI virus (was) found in Hong Kong," a spokesman for the health department said in a statement.
Only two other cases of Tamiflu-resistant H1N1 have been found so far, in Denmark and Japan.
According to the statement, the virus was isolated from a specimen taken from a 16-year-old girl coming from San Francisco, who was taken in by the Port Health Office at the Hong Kong International Airport upon arrival on June 11.
The virus was identified during the health department's routine sensitivity test of HSI virus to oseltamivir and zanamivir, the spokesman said.
Tamiflu, a tablet known generically as oseltamivir, is made by Switzerland's Roche AG and Gilead Sciences, while Relenza, an inhaled drug known generically as zanamivir, is made by GlaxoSmithKline under license from Australia's Biota Inc.
The department said that tests showed that the strain was sensitive to zanamivir.
Resistance to Tamiflu has been previously documented in the deadly bird flu virus H5N1 and seasonal H1N1 flu.
"You can always expect a certain number of resistances," said Roche spokeswoman Claudia Schmitt. "It does not necessarily mean that the strain is resistant to Tamiflu."
(Reporting by Michael Flaherty; Additional reporting by Sam Cage; Editing by Alex Richardson)

http://www.reuters.com/article/inter...5622F720090703
Reply With Quote
  #15  
Old July 3rd, 2009, 11:20 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Tamiflu-Resistant Swine Flu Virus Found in Hong Kong (Update2)


Share | Email | Print | A A A



By Nipa Piboontanasawat and Jason Gale
July 3 (Bloomberg) -- Tamiflu-resistant swine flu was found in a teenager who hadn’t taken Roche Holding AG’s best-selling antiviral medicine, Hong Kong’s health department said.
The city’s Public Health Laboratory Services Branch identified the drug-evading variant during routine surveillance of flu specimens, the department said in a statement today.
This marks the first known case of Tamiflu resistance in a swine flu patient not treated with the drug, which has been stockpiled by governments worldwide to fight pandemic influenza. The specimen was collected from a 16-year-old girl who flew from San Francisco and was intercepted by officials at Hong Kong International Airport on June 11, according to the statement.
“Picking it up in a patient who was not treated is a cause for concern,” Malik Peiris, professor of microbiology at Hong Kong University, said in an interview. “One case doesn’t change the world, but if we are seeing more and more cases in patients who are not treated, then I think it would be more serious.”
The patient, who was admitted to Queen Mary Hospital for isolation, tested positive for the new H1N1 flu strain and opted not to take Tamiflu, Hong Kong’s health department said. She had mild symptoms and was discharged upon recovery on June 18.
Denmark, Japan
Basel, Switzerland-based Roche said on June 29 that a swine flu patient treated with Tamiflu in Denmark showed resistance to the drug for the first time. Japan’s health ministry reported a case of resistance yesterday in a woman from Osaka who had taken a 10-day course.
Studies have shown that Tamiflu-resistant bugs develop in 0.4 percent to 4 percent of adults and children treated for seasonal influenza, Claudia Schmitt, a spokeswoman at Roche, said by phone from Basel today.
It’s likely the few reported cases of drug-resistant swine flu emerged independently, Hong Kong University’s Peiris said.
“The key point is whether the strains will become dominant and then we will have a problem,” he said. “At this moment, I don’t think there is cause for alarm. There is certainly cause for heightened surveillance.”
The new H1N1 pandemic virus and a seasonal H1N1 variant are more likely to develop resistance to Tamiflu than other common flu strains, Peiris said. About 95 percent of the H1N1 seasonal flu viruses circulating around the world evade the Roche pill, according to a March 21 World Health Organizationreport.
Glaxo’s Relenza
No widespread resistance to GlaxoSmithKline Plc’s flu drug Relenza has been reported in seasonal flu, and there have been no reports of resistance in swine flu.
“Constant, random mutation is the survival mechanism of the microbial world,” WHO Director-General Margaret Chan said in an address to a meeting on the flu pandemic in Cancun, Mexico, yesterday. “Like all influenza viruses, H1N1 has the advantage of surprise on its side.”
Tamiflu and Relenza, an inhaled powder, reduce the severity and the duration of flu symptoms by 24 to 30 hours if treatment is started within the first two days of illness, according to the companies.
Both drugs work by blocking a protein on the surface of influenza particles called neuraminidase, which allows the virus to spread from infected cells to other cells in the body.
Scientists say mutant H1N1 viruses have evolved to evade Tamiflu through a single mutation in the neuraminidase that prevents the medicine from clinging to the viral protein, enabling the pathogen to spread.
The case in Hong Kong indicates that the mutant virus is capable of being transmitted among people, said Jennifer McKimm- Breschkin, a virologist at the Commonwealth Science and Industrial Research Organization in Melbourne.
“It’s very disturbing that, fresh into the human population, this one appears now to be able to retain fitness despite having the mutation and to be able to spread,” she said in a telephone interview today.
To contact the reporters on this story: Nipa Piboontanasawat in Hong Kong at npiboontanas@bloomberg.net; To contact the reporters on this story: Jason Gale in Singapore at j.gale@bloomberg.net.
Last Updated: July 3, 2009 07:46 EDT

http://www.bloomberg.com/apps/news?p...d=a9GPdD61pf30
Reply With Quote
  #16  
Old July 3rd, 2009, 12:01 PM
Commonground's Avatar
Commonground Commonground is offline
Editor and Director of the Vietnam Forum
 
Join Date: May 2006
Posts: 8,933
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Has this been mentioned in earlier articles? I don't think so....

Quote:
.....said Jennifer McKimm- Breschkin, a virologist at the Commonwealth Science and Industrial Research Organization in Melbourne.
“It’s very disturbing that, fresh into the human population, this one appears now to be able to retain fitness despite having the mutation and to be able to spread,” she said in a telephone interview today.
__________________
My Blog: http://pandemicinformationnews.blogspot.com/
Reply With Quote
  #17  
Old July 3rd, 2009, 01:41 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Commentary
Reply With Quote
  #18  
Old July 3rd, 2009, 01:50 PM
DeniseMc DeniseMc is offline
Registered User
 
Join Date: May 2009
Location: Texas
Posts: 31
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Niman, I know that in the past you have expressed the opinion that this pandemic will follow the pattern of the 1918 Spanish flu pandemic. I believe that the spring/summer outbreak in 1918 died down in August and peaked again in October and February. Do you envision that happening again, or do you believe that this novel H1N1 will be one continuous wave rather than the herald wave followed by subsequent second and third waves?

Also, what is your opinion regarding the virus circulating in Argentina and New Zealand and elsewhere in the southern hemisphere? Do you believe that it is a strain that has adapted to spread faster in humans (temperature adjustment) or the original strain? Do you think they are circulating simultaneously, one on the southern hemispehre and one in the northern? Have there been enough sequences published to determine which one is dominant now?

Thanks for your opinions.
Reply With Quote
  #19  
Old July 3rd, 2009, 02:07 PM
AlaskaDenise's Avatar
AlaskaDenise AlaskaDenise is offline
Editor, Senior Moderator
 
Join Date: Mar 2006
Posts: 8,703
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu (7/3/09)

Quote:
Originally Posted by niman View Post
Commentary

Surveillance Flaws Drive Silent Spread of Tamiflu Resistant H1N1

Recombinomics Commentary 15:18
July 3, 2009


The virus was isolated from the specimen taken from a 16-year-old girl coming from San Francisco. She was intercepted by Port Health Office at the Hong Kong International Airport on June 11 upon arrival. The girl was then admitted to Queen Mary Hospital for isolation. She was tested positive to HSI but opted not to take tamiflu. She had mild symptoms and was eventually discharged upon recovery on June 18.


The above comments from a Hong Kong DOH press release on Tamiflu resistance in pandemic H1N1 highlight severe limitations in worldwide surveillance. Although this case was identified by routine surveillance of H1N1 positive patients in Hong Kong, it is an effort largely focused on travelers. Like countries outside of the Americas, most efforts have focused on travelers and largely ignored local community spread. The recent explosion in cases in the UK has led to a focus on the community spread there, but many other counties in Europe are reporting low numbers of confirmed pandemic H1N1 because of limited testing in the community.

In the US, efforts are focused on the community, but severe cases are targetted. Most states have stopped reporting and testing mild cases, so real monitoring of this group is minimal. However, the case in Hong Kong originated in San Francisco and was mild. The United States has not reported any Tamiflu resistance. The CDC has tested over 200 isolates and failed to identify H274Y.


This may be due in part to virus mixtures. In Denmark and Japan the H274Y was discovered in patients undergoing Tamiflu prophylactic treatment. The Tamiflu treatment would reduce wild type H1N1 and allow a minor population with H274Y to expand and be detected. Therefore, it is likely that the H274Y is spreading silently and under the radar of the sequencing efforts, which are focused on the dominant (consensus) sequence.


The acquisition of H274Y by pandemic H1N1 was not unexpected. H274Y has a history of jumping from one sub-clade to another, as well as jumping to multiple different backgrounds within a subclade via recombination and genetic hitchhiking. This has produced resistance that is limited to H1N1 and H274Y within H1N1. The co-circulation of human H1N1 seasonal flu with swine H1N1 in humans, has created a favorable environment for the jump of H274Y from seasonal flu to pandemic flu. Moreover, the widespread use of Tamiflu in patients infected with pandemic H1N1 will drive the rate of spread in pandemic H1N1.


Although countries have been placing sequences on deposit in a timely manner, there are still major deficiencies in the surveillance program, as described above. Moreover, the recent reports of Tamiflu resistance in isolates in Denmark, Japan, and Hong Kong have not lead to the release of these sequences.


An increase in surveillance and release of full sequences is still necessary. The pandemic H1N1 is now rapidly spreading in the southern hemisphere, which is just beginning its flu season. Sequences from fatal and mild cases are required to determine important changes in pandemic H1N1 associated with increased virulence as well as increased spread.


A serious comprehensive surveillance program is long overdue.


.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
Reply With Quote
  #20  
Old July 3rd, 2009, 02:09 PM
AlaskaDenise's Avatar
AlaskaDenise AlaskaDenise is offline
Editor, Senior Moderator
 
Join Date: Mar 2006
Posts: 8,703
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Quote:
Originally Posted by niman View Post
Commentary

Lesson Not Learned in H1N1 Tamiflu Resistant Spread

Recombinomics Commentary 18:26
July 3, 2009

"Picking it up in a patient who was not treated is a cause for concern," Malik Peiris, professor of microbiology at Hong Kong University, said in an interview. "One case doesn't change the world, but if we are seeing more and more cases in patients who are not treated, then I think it would be more serious."

The patient, who was admitted to Queen Mary Hospital for isolation, tested positive for the new H1N1 flu strain and opted not to take Tamiflu, Hong Kong's health department said. She had mild symptoms and was discharged upon recovery on June 18.

"The key point is whether the strains will become dominant and then we will have a problem," he said. "At this moment, I don't think there is cause for alarm. There is certainly cause for heightened surveillance."

"Constant, random mutation is the survival mechanism of the microbial world," WHO Director-General Margaret Chan said in an address to a meeting on the flu pandemic in Cancun, Mexico, yesterday. "Like all influenza viruses, H1N1 has the advantage of surprise on its side."

Studies have shown that Tamiflu-resistant bugs develop in 0.4 percent to 4 percent of adults and children treated for seasonal influenza, Claudia Schmitt, a spokeswoman at Roche, said by phone from Basel today.

The above comments on the emergence of H274Y and associated oseltamivir (Tamiflu) resistance clearly show that lessons were not learned from the spread of H274Y in seasonal flu (limited to H1N1). The spread of H274Y in seasonal flu destroyed the old paradigm of influenza evolution by selection of "random mutations", but as seen above, WHO is still citing that mechanism to try to explain the emergence of H274Y in pandemic H1N1 in Denmark, Japan, Hong Kong and San Francisco.

Roche is still citing old data on the emergence of resistance in Japan years ago, when children were treated with sub-optical doses. That data provided a classical example of resistance, which was linked to the sub-optimal dosing, as well as mutations in H1N1 and H3N2 at multiple locations within each sero-type. However, those changes were only viable in the presence of Tamiflu, which killed off the competing wild type strains.

In 2005 when resistance developed in treated patients or contacts infected with H5N1 the same assurances on lack of fitness and failure to spread were offered. The first example was a patient on a prophylactic dose because her brother was a confirmed case. She developed an infection, but responded to a therapeutic dose, even though H5N1 with H274Y as well as N296S was identified in sub-clones from the patient.

Although the spread of resistant H5N1 in patients was not reported, the appearance of H274Y in H1N1 in wild birds later that year was cause for concern. The wild birds in Russia were not given oseltamivir, yet H5N1 was isolated from dead birds indicating H5N1 with H274Y was evolutionarily fit, leading to transmission between birds and fatal infections.

Concerns of H274Y were increased the following year when it was reported in seasonal flu in China. The clade 2C (Hong Kong strain) with H274Y was found in patients who were not taking Tamiflu, again showing that evolutionarily fit could transmit to humans who were not taking Tamiflu.

The following season (2006/2007), H274Y jumped to another H1N1 sub-clade (clade 1 - New Caledonia strain) in the United States and United Kingdom. The multiple sub-clades within clade 1 signaled multiple introductions into patients not taking Tamiflu.

The following season (2007/2008), H274Y jumped again. Initial cases in the United States were in Hawaii were clade 2B (Brisbane strain), but did not spread. However, the H274Y jumped onto another clade 2B sub-clade which did spread in the United States and Europe. This sub-clade was initially reported in Norway in early 2008, but had been silently spreading throughout the fall.

In the summer of 2008 the H274Y in combination with HA A193T emerged, which then led to the fixing of H274Y at levels approaching 100% of H1N1. The A193T, as well as several additional polymorphisms had been co-circulating on clade 2C. The acquisition of these polymorphisms, including three consecutive polymorphisms in NA signaled recombination, because the NA polymorphisms were not only consecutive, but included a synonymous change, which offered no obvious selection pressure.

Thus, the data was inconsistent with a "random mutation" mechanism. The key changes were co-circulating on a related sub-clade, and were appended onto a clade 2B backbone. The H274Y jumped from background to background in patients who were not taking Tamiflu. This spread of H274Y via recombination and genetic hitchhiking did not require de novo mutations. The key polymorphisms were already circulating in clade 2C, and had earlier been found in other H1N1 or H1N2 isolates.

The mechanism of evolution raised serious concerns when swine H1N1 acquire efficient transmission in humans. This transmission offered the opportunity of genetic exchanges between human seasonal H1N1 and swine H1N1 which was now also in humans. Dual infections would allow for H274Y jumping form seasonal flu to pandemic flu in patients infected with both viruses.

Thus, the detection of H274Y in Denmark this week was not a surprised. However, since the patient had been on a prophylactic dose of oseltamivir, the random mutation paradigm was used to explain the data and offer assurances that the resistance wouldn't spread. However, the appearance of H274Y in the treated patient raised concerns that H274Y was lurking in a minor sub-population that was missing in sequencing of untreated patients, and was detected only in treated patients.

The data from Denmark was repeated in Japan this week, when another patient being treated with a prophylactic dose of oseltamivir also gave rise to the detection of H274Y. However, the appearance of H274Y in the absence of other resistance changes raised concerns that H274Y had already been acquired via recombination and was silently spreading in association with wild type H1N1.

The concerns were increased by the announcement in Hong Kong at a traveler from San Francisco, who was not taking Tamiflu was harboring a resisitant sequence, which was almost certainly H274Y. The presence of resistance in a patient not taking Tamiflu indicated the pandemic H1N1 with H274Y was evolutionarily fit and not only was in Hong Kong, but was also in San Francisco, the origin of the traveler.

However, H274Y has not been reported in the United States, raising serious surveillance concerns. Most efforts are directed to hospitalized serious cases, and state across the country announced that they were no longer testing mild cases. However, the Hong Kong, ex-San Francisco case was mild, which may explain the lack of detection.

However, of greater concern is the ability of H274Y to jump from one background to another in the absence of oseltamivir selection.

However, statements above indicate the lesson from seasonal flu was not learned, and the old discredited random mutation explain is once again offered, along with assurances that the H274Y will not spread (even after it has been found or implied on three continents).

Increased surveillance will demonstrate not only that H274Y can spread, but that it has already spread, under the radar of the current surveillance system. Moreover, the reliance of the old "random mutation" paradigm will lead to more "surprises" but those who adhere to an paradigm which is inconsistent with the sequence data.

An increase in surveillance and sequencing will allow for more accurate products of future acquisitions, which are due to recombination and not due to de novo mutations, as repeated again and again by those who ignore the data, or quote those who ignore the data.

.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
Reply With Quote
  #21  
Old July 3rd, 2009, 02:21 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Quote:
Originally Posted by DeniseMc View Post
Niman, I know that in the past you have expressed the opinion that this pandemic will follow the pattern of the 1918 Spanish flu pandemic. I believe that the spring/summer outbreak in 1918 died down in August and peaked again in October and February. Do you envision that happening again, or do you believe that this novel H1N1 will be one continuous wave rather than the herald wave followed by subsequent second and third waves?

Also, what is your opinion regarding the virus circulating in Argentina and New Zealand and elsewhere in the southern hemisphere? Do you believe that it is a strain that has adapted to spread faster in humans (temperature adjustment) or the original strain? Do you think they are circulating simultaneously, one on the southern hemispehre and one in the northern? Have there been enough sequences published to determine which one is dominant now?

Thanks for your opinions.
The virus has a lot to work with and although sequences are being deposited promptly, there are many holes in the database as well as delays. Although H274Y has now been reported in Denmark, Japan, and Hong Kong (in a patient who arrived from San Francisco and didn't take tamiflu), the number of pandemic H1n1 sequences with H274Y remains are ZERO (as of this morning). The PB2 E627K was in the original and first clone from Shanghai, but not the second clone.
There are a lot of open issues with teh sequences.

Most deatsh in South America, including Argentina, were in the past week, so these sequences are not available.

The rapid rise in deaths in the southern hemisphere signals a change, but its not obvious in the database yet.

I expect the virus to evolve, and to evolve more rapidly as the flu season grows in the soiuthern hemisphere and more of the population develops antibodies to the current strain.

The virus is just starting to roll and one or two minor changes can have a MAJOR effect.

Right now it still looks like a 1918 train wreck between trains on the same track which are gathering speed and heading towards each other.
Reply With Quote
  #22  
Old July 3rd, 2009, 02:23 PM
AlaskaDenise's Avatar
AlaskaDenise AlaskaDenise is offline
Editor, Senior Moderator
 
Join Date: Mar 2006
Posts: 8,703
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Quote:
.....not only was in Hong Kong, but was also in San Francisco, the origin of the traveler.
I don't see any reports saying she was a resident of California. She could have been from HK and was visiting San Francisco. If she traveled with a group, someone else in that group could have infected her.

For that matter she could have been from anywhere and simply had a layover in San Francisco before traveling to HK.

.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
Reply With Quote
  #23  
Old July 3rd, 2009, 02:26 PM
wotan wotan is offline
Senior User
 
Join Date: Apr 2009
Location: Katy, TX
Posts: 781
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Quote:
Originally Posted by AlaskaDenise View Post
I don't see any reports saying she was a resident of California. She could have been from HK and was visiting San Francisco. If she traveled with a group, someone else in that group could have infected her.

For that matter she could have been from anywhere and simply had a layover in San Francisco before traveling to HK.

.
Those may all be true, but there is a strong implication that the resistance at the least had its origins in the western hemisphere. Something tells me you don't fly from Berlin to HK by way of San Francisco.
__________________
Wotan (pronounced Voton with the ton rhyming with on) - The German Odin, ruler of the Aesir.

I am not a doctor, virologist, biologist, etc. I am a layman with a background in the physical sciences.

Attempting to blog an nascent pandemic: Diary of a Flu Year
Reply With Quote
  #24  
Old July 3rd, 2009, 02:36 PM
AlaskaDenise's Avatar
AlaskaDenise AlaskaDenise is offline
Editor, Senior Moderator
 
Join Date: Mar 2006
Posts: 8,703
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

It's highly probable she could be traveling HK to CA to HK. Also, Toronto to SF to HK, or Cancun to SF to HK. Or HK to west coast cruise to SF to HK.

.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
Reply With Quote
  #25  
Old July 3rd, 2009, 02:50 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Quote:
Originally Posted by AlaskaDenise View Post
I don't see any reports saying she was a resident of California. She could have been from HK and was visiting San Francisco. If she traveled with a group, someone else in that group could have infected her.

For that matter she could have been from anywhere and simply had a layover in San Francisco before traveling to HK.

.
Lost of woulda couldas shoulda's but ZERO sequences. Although Denmark, Japan, and Hong Kong have all described the resistance, none have sequences on deposit. San Francisco to Kong Kong is a long plane ride and others could have been infected in flight.

It is past time to step up sequencing and data release. California sequences from CDC seem to be from patients infected in April.

There is a serious data lag with MAJOR database holes, even in the US.

I STRONG suspect H274Y is widespead and silently spreading in mild cases, including the US where mild cases are NOT even tested at this point.
Reply With Quote
  #26  
Old July 3rd, 2009, 03:03 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Here;s data for Hawaii at Genbank. One NA sequence that was just deposited from a collection in April

LOCUS GQ338360 1410 bp cRNA linear VRL 01-JUL-2009
DEFINITION Influenza A virus (A/Hawaii/09/2009(H1N1)) segment 6 neuraminidase
(NA) gene, complete cds.
ACCESSION GQ338360
VERSION GQ338360.1 GI:243031419
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Hawaii/09/2009(H1N1))
ORGANISM Influenza A virus (A/Hawaii/09/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1410)
AUTHORS Garten,R.
TITLE Direct Submission
JOURNAL Submitted (01-JUL-2009) Centers for Disease Control and Prevention,
NCIRD/Influenza Division/VSDB, Centers for Disease Control and
Prevention, Atlanta, 1600 Clifton Road, N.E., Atlanta, GA 30333,
USA
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009. For more information, see http://www.cdc.gov/.

Some of the information does not have GenBank feature identifiers
and is being provided in the comment section.

##EpifluData-START##
Isolate A/Hawaii/09/2009
Subtype H1N1
Segment_name NA
Host_gender F
Host_age 37
Passage_history C1
Antigen_character A/California/07/2009-LIKE (H1N1)V
Adamantane_resistance resistant
Zanamivir_resistance sensitive
Oseltamivir_resistance sensitive
Country USA
State/Province Hawaii state
Collection_day 30
Collection_month 4
Collection_year 2009
Isolate_note Comment: Human case of 2009 H1N1 swine
influenza.
EPI_accession EPI184367
Lineage swl
##EpifluData-END##
FEATURES Location/Qualifiers
source 1..1410
/organism="Influenza A virus (A/Hawaii/09/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Hawaii/09/2009"
/serotype="H1N1"
/host="Homo sapiens; gender F; age 37"
/db_xref="taxon:656491"
/segment="6"
/country="USA: Hawaii state"
/collection_date="30-Apr-2009"
gene 1..1410
/gene="NA"
CDS 1..1410
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="ACS94509.1"
/db_xref="GI:243031420"
/translation="MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQN
QIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPV GGWAIYSK
DNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDR SPYRTLMS
CPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNG IITDTIKS
WRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVE MNAPNYHY
EECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNP RPNDKTGS
CGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTD NNFSIKQD
IVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSS ISFCGVNS
DTVGWSWPDGAELPFTIDK"
ORIGIN
1 atgaatccaa accaaaagat aataaccatt ggttcggtct gtatgacaat tggaatggct
61 aacttaatat tacaaattgg aaacataatc tcaatatgga ttagccactc aattcaactt
121 gggaatcaaa atcagattga aacatgcaat caaagcgtca ttacttatga aaacaacact
181 tgggtaaatc agacatatgt taacatcagc aacaccaact ttgctgctgg acagtcagtg
241 gtttccgtga aattagcggg caattcctct ctctgccctg ttggtggatg ggctatatac
301 agtaaagaca acagtgtaag aatcggttcc aagggggatg tgtttgtcat aagggaacca
361 ttcatatcat gctccccctt ggaatgcaga accttcttct tgactcaagg ggccttgcta
421 aatgacaaac attccaatgg aaccattaaa gacaggagcc catatcgaac cctaatgagc
481 tgtcctattg gtgaagttcc ctctccatac aactcaagat ttgagtcagt cgcttggtca
541 gcaagtgctt gtcatgatgg catcaattgg ctaacaattg gaatttctgg cccagacaat
601 ggggcagtgg ctgtgttaaa gtacaacggc ataataacag acactatcaa gagttggaga
661 aacaatatat tgagaacaca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
721 gtaatgaccg atggaccaag taatggacag gcctcataca agatcttcag aatagaaaag
781 ggaaagatag tcaaatcagt cgaaatgaat gcccctaatt atcactatga ggaatgctcc
841 tgttatcctg attctagtga aatcacatgt gtgtgcaggg ataactggca tggctcgaat
901 cgaccgtggg tgtctttcaa ccagaatctg gaatatcaga taggatacat atgcagtggg
961 attttcggag acaatccacg ccctaatgat aagacaggca gttgtggtcc agtatcgtct
1021 aatggagcaa atggagtaaa aggattttca ttcaaatacg gcaatggtgt ttggataggg
1081 agaactaaaa gcattagttc aagaaacggt tttgagatga tttgggatcc gaacggatgg
1141 actgggacag acaataactt ctcaataaag caagatatcg taggaataaa tgagtggtca
1201 ggatatagcg ggagttttgt tcagcatcca gaactaacag ggctggattg tataagacct
1261 tgcttctggg ttgaactaat cagagggcga cccaaagaga acacaatctg gactagcggg
1321 agcagcatat ccttttgtgg tgtaaacagt gacactgtgg gttggtcttg gccagacggt
1381 gctgagttgc catttaccat tgacaagtaa

Reply With Quote
  #27  
Old July 3rd, 2009, 03:09 PM
gjs47's Avatar
gjs47 gjs47 is offline
Registered User
 
Join Date: Aug 2006
Location: Utah
Posts: 86
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

At this time there appears to be one reliable and accessible source of correct information on what's really going on. If that's really the case, protecting that source and supply would be a priority.

We watched the spread of the current version, even as it affected your school district and locale. You kept an continuous update on the current status at that time.

Are you prepared to sip? If so, and knowing the changing situation and it's pending possibilities and/or probabilities, at what point are you going to sip? Are you going to send an advisory to notify others that you have made that decision?

Thank you for all you do and say.
Reply With Quote
  #28  
Old July 3rd, 2009, 03:13 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

The seventh imported case involved a 10-year-old girl. She returned to Hong Kong from San Francisco by taking a flight of Singapore Airlines (flight no. SQ1) on June 11. She sat in row 50 of the flight.

http://www.chp.gov.hk/content.asp?la...d=17467&id=116
Reply With Quote
  #29  
Old July 3rd, 2009, 03:15 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

The seventh case is a 15-year-old girl studying in the United States. She returned to Hong Kong via Tokyo on June 11 by taking a flight of Northwest Airlines (flight no. NW7). She sat in row 33 of the flight.

She developed sore throat on June 11 and fever on the next day. She was admitted to UCH on June 12 for isolation.

http://www.chp.gov.hk/content.asp?la...d=17457&id=116
Reply With Quote
  #30  
Old July 3rd, 2009, 03:20 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: Hong Kong: Detection of human swine influenza virus resistant to Tamiflu in person from USA

Quote:
Originally Posted by niman View Post
The seventh case is a 15-year-old girl studying in the United States. She returned to Hong Kong via Tokyo on June 11 by taking a flight of Northwest Airlines (flight no. NW7). She sat in row 33 of the flight.

She developed sore throat on June 11 and fever on the next day. She was admitted to UCH on June 12 for isolation.

http://www.chp.gov.hk/content.asp?la...d=17457&id=116

Flight Schedule 1
Flight: NW 344




Departs: San Francisco-Int'l, CA (SFO) at 12:30AM
Arrives: Detroit-Wayne County Int'l, MI (DTW) at 07:56AM
Flight: NW 25




Departs: Detroit-Wayne County Int'l, MI (DTW) at 03:20PM
Arrives: Tokyo-Narita, Japan (NRT) at 05:05PM
Flight: NW 29




Departs: Tokyo-Narita, Japan (NRT) at 06:50PM
Arrives: Hong Kong-Int'l, Hong Kong (HKG) at 10:20PM +1
Reply With Quote
Reply


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is On

Disclaimer:

The reader is responsible for discerning the validity, factuality or implications of information posted here, be it fictional or based on real events. Moderators on this forum make every effort to review the material posted on this site however, it is not realistically possible for our staff to manually review each post.

The content of posts on this site, including but not limited to links to other web sites, are the expressed opinion of the original authors or posters and are not endorsed by, or representative of the opinions of, the owners or administration of this website. The posts on this website are the opinion of the specific author or poster and should not be construed as statements of advice or factual information.

Not all posts on this website are intended as truthful or factual assertion by their authors. NO posts on this website should be considered factual information on face value alone. Users are encouraged to USE DISCERNMENT and do their own follow up research while reading and posting on this website. FluTrackers.com Inc. reserves the right to make changes to, corrections and/or remove entirely at any time posts made on this website without notice. In addition, FluTrackers.com Inc. disclaims any and all liability for damages incurred directly or indirectly as a result of a post on this website.

This site is provided "as is" without warranty of any kind, either expressed or implied. You should not assume that this site is error-free or that it will be suitable for the particular purpose which you have in mind when using it. In no event shall FluTrackers.com Inc. be liable for any special, incidental, indirect or consequential damages of any kind, or any damages whatsoever, including, without limitation, those resulting from loss of use, data or profits, whether or not advised of the possibility of damage, and on any theory of liability, arising out of or in connection with the use or performance of this site or other documents which are referenced by or linked to this site.

Finally, FluTrackers.com Inc. reserves the right to delete, correct, or make changes to any post on this website without notice at any time for any reason.

Fair Use Notice:
This site may contain copyrighted material the use of which has not always been specifically authorized by the copyright owner. Users may make such material available in an effort to advance awareness and understanding of issues relating to public health, civil rights, economics, individual rights, international affairs, liberty, science & technology, etc. We believe this constitutes a 'fair use' of any such copyrighted material as provided for in section 107 of the US Copyright Law. In accordance with Title 17 U.S.C.Section 107, the material on this site is distributed to those who have expressed a prior interest in receiving the included information for research and educational purposes.

In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article. Please remember you are responsible for what you post on the internet and you could be sued by the original copyright holder if you do not honor these rules.

If you are a legal copyright holder or a designated agent for such and you believe a post on this website falls outside the boundaries of "Fair Use" and legitimately infringes on yours or your clients copyright

we may be contacted concerning copyright matters at:

FluTrackers.com Inc.
c/o Sharon Sanders
1676 Hibiscus Avenue
Winter Park, Florida 32789
Phone: 407-406-3037
E-Mail: flutrackers@earthlink.net

In accordance with section 512 of the U.S. Copyright Act our contact information has been registered with the United States Copyright Office. "Safe Harbor" noticing procedures as outlined in the DMCA apply to this website concerning all 3rd party posts published herein.

If notice is given of an alleged copyright violation we will act expeditiously to remove or disable access to the material(s) in question.

All 3rd party material posted on this website is the copyright of the respective owners / authors. FluTrackers.com Inc. makes no claim of copyright on such material.

For more information please visit: http://www.law.cornell.edu/uscode/17/107.shtml

Please be aware any communications sent complaining about a post on this website may be posted publicly at the discretion of the administration.

FluTrackers Does Not Provide Any Medical Advice:

FluTrackers, Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster.

The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website.

By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.

By using and/or accessing this site, either passively or actively, you are agreeing to all of the above conditions. Also, by using and/or accessing this site, either passively or actively, you agree to conduct all business and legal affairs related to this website in the jurisdiction of Flutrackers.com Inc. which is registered in Central Florida, USA.

These Disclaimers are subject to change at anytime.

Email the Webmaster with questions or comments about this site at flutrackers@earthlink.net


All times are GMT -4. The time now is 05:15 PM.