 |
|

July 6th, 2009, 05:20 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Hong Kong has released the sequence of Tamiflu resistant NA.
|

July 6th, 2009, 05:20 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
LOCUS GQ351316 1410 bp cRNA linear VRL 06-JUL-2009
DEFINITION Influenza A virus (A/Hong Kong/2369/2009(H1N1)) segment 6
neuraminidase (NA) gene, complete cds.
ACCESSION GQ351316
VERSION GQ351316.1 GI:251748197
DBLINK Project: 37813
KEYWORDS .
SOURCE Influenza A virus (A/Hong Kong/2369/2009(H1N1))
ORGANISM Influenza A virus (A/Hong Kong/2369/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1410)
AUTHORS Tai,A.L.S., Cheng,P.K.C., Leung,T.W.C. and Lim,W.W.L.
TITLE Direct Submission
JOURNAL Submitted (05-JUL-2009) Virology Division, PHLSB, Centre for Health
Protection, 382 Nam Cheong Street, Shek Kip Mei, Kolwoon, Hong
Kong, China
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
FEATURES Location/Qualifiers
source 1..1410
/organism="Influenza A virus (A/Hong
Kong/2369/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Hong Kong/2369/2009"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon: 657077"
/segment="6"
/country="China: Hong Kong"
/collection_date="11-Jun-2009"
/note="lineage: swl"
gene 1..1410
/gene="NA"
CDS 1..1410
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id=" ACT10319.1"
/db_xref="GI:251748198"
/translation="MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQN
QIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPV SGWAIYSK
DNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDR SPYRTLMS
CPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNG IITDTIKS
WRNNILRTQESECACVNGSCFTVMTDGPSDGQASYKIFRIEKGKIVKSVE MNAPNYYY
EECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNP RPNDKTGS
CGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTD NNFSIKQD
IVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSS ISFCGVNS
DTVGWSWPDGAELPFTIDK"
ORIGIN
1 atgaatccaa accaaaagat aataaccatt ggttcggtct gtatgacaat tggaatggct
61 aacttaatat tacaaattgg aaacataatc tcaatatgga ttagccactc aattcaactt
121 gggaatcaaa atcagattga aacatgcaat caaagcgtca ttacttatga aaacaacact
181 tgggtaaatc agacatatgt taacatcagc aacaccaact ttgctgctgg acagtcagtg
241 gtttccgtga aattagcggg caattcctct ctctgccctg ttagtggatg ggctatatac
301 agtaaagaca acagtataag aatcggttcc aagggggatg tgtttgtcat aagggaacca
361 ttcatatcat gctccccctt ggaatgcaga accttcttct tgactcaagg ggccttgcta
421 aatgacaaac attccaatgg aaccattaaa gacaggagcc catatcgaac cctaatgagc
481 tgtcctattg gtgaagttcc ctctccatac aactcaagat ttgagtcagt cgcttggtca
541 gcaagtgctt gtcatgatgg catcaattgg ctaacaattg gaatttctgg cccagacaat
601 ggggcagtgg ctgtgttaaa gtacaacggc ataataacag acactatcaa gagttggaga
661 aacaatatat tgagaacaca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
721 gtaatgaccg atggaccaag tgatggacag gcctcataca agatcttcag aatagaaaag
781 ggaaagatag tcaaatcagt cgaaatgaat gcccctaatt attactatga ggaatgctcc
841 tgttatcctg attctagtga aatcacatgt gtatgcaggg ataactggca tggctcgaat
901 cgaccgtggg tgtctttcaa ccagaatctg gaatatcaga taggatacat atgcagtggg
961 attttcggag acaatccacg ccctaatgat aagacaggca gttgtggtcc agtatcgtct
1021 aatggagcaa atggagtaaa aggattttca ttcaaatacg gcaatggtgt ttggataggg
1081 agaactaaaa gcattagttc aagaaacggt tttgagatga tttgggatcc gaacggatgg
1141 actgggacag acaataactt ctcaataaag caagatatcg taggaataaa tgagtggtca
1201 ggatatagcg ggagttttgt tcagcatcca gaactaacag ggctggattg tataagacct
1261 tgcttctggg ttgaactaat cagagggcga cccaaagaga acacaatctg gactagcggg
1321 agcagcatat ccttttgtgg tgtaaacagt gacactgtgg gttggtcttg gccagacggt
1381 gctgagttgc catttaccat tgacaagtaa
|

July 6th, 2009, 05:21 PM
|
|
Administrator, Editor
|
|
Join Date: Feb 2006
Posts: 4,768
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
can't wait to hear the results.
|

July 6th, 2009, 05:28 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Jersey girl
|

July 6th, 2009, 05:30 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
NA identical to sequence below (except for H274Y)
LOCUS GQ160533 1410 bp cRNA linear VRL 15-MAY-2009
DEFINITION Influenza A virus (A/New Jersey/01/2009(H1N1)) segment 6
neuraminidase (NA) gene, complete cds.
ACCESSION GQ160533
VERSION GQ160533.1 GI:237651369
DBLINK Project: 37813
KEYWORDS .
SOURCE Influenza A virus (A/New Jersey/01/2009(H1N1))
ORGANISM Influenza A virus (A/New Jersey/01/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1410)
AUTHORS Shu,B., Balish,A., Garten,R., Smith,C., Emery,S., Barnes,J.,
Deyde,V., Klimov,A. and Cox,N.
TITLE Human infection with novel swine H1N1 influenza
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1410)
AUTHORS Shu,B., Balish,A., Garten,R., Smith,C., Emery,S., Barnes,J.,
Deyde,V., Klimov,A. and Cox,N.
TITLE Direct Submission
JOURNAL Submitted (14-MAY-2009) WHO Collaborating Center for Surveillance,
Epidemiology and Control of Influenza, Influenza Division, Centers
for Disease Control and Prevention, 1600 Clifton Road, N.E.,
Atlanta, GA 30333, USA
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009. For more information, see http://www.cdc.gov/.
Some of the information does not have GenBank feature identifiers
and is being provided in the comment section.
##EpifluData-START##
Isolate A/New Jersey/01/2009
Subtype H1N1
Segment_name NA
Host_gender F
Host_age 12
Passage_history C1
Adamantane_resistance resistant
Zanamivir_resistance sensitive
Oseltamivir_resistance sensitive
Country USA
State/Province New Jersey state
Collection_month 4
Collection_year 2009
EPI_accession EPI179148
##EpifluData-END##
FEATURES Location/Qualifiers
source 1..1410
/organism="Influenza A virus (A/New Jersey/01/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/New Jersey/01/2009"
/serotype="H1N1"
/host="Homo sapiens; gender F; age 12"
/db_xref="taxon: 645236"
/segment="6"
/country="USA:New Jersey state"
/collection_date="Apr-2009"
gene 1..1410
/gene="NA"
CDS 1..1410
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id=" ACR08567.1"
/db_xref="GI:237651370"
/translation="MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQN
QIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPV SGWAIYSK
DNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDR SPYRTLMS
CPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNG IITDTIKS
WRNNILRTQESECACVNGSCFTVMTDGPSDGQASYKIFRIEKGKIVKSVE MNAPNYHY
EECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNP RPNDKTGS
CGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTD NNFSIKQD
IVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSS ISFCGVNS
DTVGWSWPDGAELPFTIDK"
ORIGIN
1 atgaatccaa accaaaagat aataaccatt ggttcggtct gtatgacaat tggaatggct
61 aacttaatat tacaaattgg aaacataatc tcaatatgga ttagccactc aattcaactt
121 gggaatcaaa atcagattga aacatgcaat caaagcgtca ttacttatga aaacaacact
181 tgggtaaatc agacatatgt taacatcagc aacaccaact ttgctgctgg acagtcagtg
241 gtttccgtga aattagcggg caattcctct ctctgccctg ttagtggatg ggctatatac
301 agtaaagaca acagtataag aatcggttcc aagggggatg tgtttgtcat aagggaacca
361 ttcatatcat gctccccctt ggaatgcaga accttcttct tgactcaagg ggccttgcta
421 aatgacaaac attccaatgg aaccattaaa gacaggagcc catatcgaac cctaatgagc
481 tgtcctattg gtgaagttcc ctctccatac aactcaagat ttgagtcagt cgcttggtca
541 gcaagtgctt gtcatgatgg catcaattgg ctaacaattg gaatttctgg cccagacaat
601 ggggcagtgg ctgtgttaaa gtacaacggc ataataacag acactatcaa gagttggaga
661 aacaatatat tgagaacaca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
721 gtaatgaccg atggaccaag tgatggacag gcctcataca agatcttcag aatagaaaag
781 ggaaagatag tcaaatcagt cgaaatgaat gcccctaatt atcactatga ggaatgctcc
841 tgttatcctg attctagtga aatcacatgt gtatgcaggg ataactggca tggctcgaat
901 cgaccgtggg tgtctttcaa ccagaatctg gaatatcaga taggatacat atgcagtggg
961 attttcggag acaatccacg ccctaatgat aagacaggca gttgtggtcc agtatcgtct
1021 aatggagcaa atggagtaaa aggattttca ttcaaatacg gcaatggtgt ttggataggg
1081 agaactaaaa gcattagttc aagaaacggt tttgagatga tttgggatcc gaacggatgg
1141 actgggacag acaataactt ctcaataaag caagatatcg taggaataaa tgagtggtca
1201 ggatatagcg ggagttttgt tcagcatcca gaactaacag ggctggattg tataagacct
1261 tgcttctggg ttgaactaat cagagggcga cccaaagaga acacaatctg gactagcggg
1321 agcagcatat ccttttgtgg tgtaaacagt gacactgtgg gttggtcttg gccagacggt
1381 gctgagttgc catttaccat tgacaagtaa
|

July 6th, 2009, 05:32 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by hawkeye
can't wait to hear the results.
|
Hopes and dreams of reassorters dashed. It is swine NA, and exactly matches NJ isolate and only one difference (besides H274Y) with larger series.
|

July 6th, 2009, 05:45 PM
|
|
Senior User
|
|
Join Date: Oct 2006
Posts: 384
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Is it tamiflu resistant Dr niman....?,thanks.
|

July 6th, 2009, 05:54 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by vinny
Is it tamiflu resistant Dr niman....?,thanks.
|
Only the Hong Kong sequence has H274Y.
|

July 6th, 2009, 05:57 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Travel log of polymorphism shared with NJ (and OK) in pandemic H1N1.
gb|GQ338380.1| Influenza A virus (A/Oklahoma/03/2009(H1N1)) s... 30.2 45
gb|CY041452.1| Influenza A virus (A/California/UR06-0439/2007... 30.2 45
gb|GQ160533.1| Influenza A virus (A/New Jersey/01/2009(H1N1))... 30.2 45
gb|CY032399.1| Influenza A virus (A/equine/Sao Paulo/1/1969(H... 30.2 45
gb|CY032295.1| Influenza A virus (A/equine/Sao Paulo/6/1963(H... 30.2 45
gb|EU409969.1| Influenza A virus (A/swine/Ohio/K1207/06(H1N1)... 30.2 45
gb|EU516136.1| Influenza A virus (A/New Mexico/05/2007(H1N1))... 30.2 45
gb|EU516135.1| Influenza A virus (A/Alaska/01/2007(H1N1)) seg... 30.2 45
gb|EU429796.1| Influenza A virus (A/chicken/Germany/N/1949(H1... 30.2 45
gb|CY028774.1| Influenza A virus (A/Virginia/UR06-0361/2007(H... 30.2 45
gb|CY028461.1| Influenza A virus (A/California/UR06-0442/2007... 30.2 45
gb|CY028421.1| Influenza A virus (A/Illinois/UR06-0215/2007(H... 30.2 45
gb|CY028405.1| Influenza A virus (A/Ohio/UR06-0429/2007(H1N1)... 30.2 45
gb|EU158122.1| Influenza A virus (A/mallard/Italy/250/02(H7N1... 30.2 45
gb|CY028149.1| Influenza A virus (A/Kentucky/UR06-0182/2007(H... 30.2 45
gb|CY028141.1| Influenza A virus (A/Kansas/UR06-0191/2007(H1N... 30.2 45
gb|CY028069.1| Influenza A virus (A/Illinois/UR06-0093/2007(H... 30.2 45
gb|CY027941.1| Influenza A virus (A/Virginia/UR06-0295/2007(H... 30.2 45
gb|CY027845.1| Influenza A virus (A/California/UR06-0125/2007... 30.2 45
gb|CY027821.1| Influenza A virus (A/Illinois/UR06-0074/2007(H... 30.2 45
gb|CY027765.1| Influenza A virus (A/Ohio/UR06-0112/2007(H1N1)... 30.2 45
gb|CY027709.1| Influenza A virus (A/Virginia/UR06-0549/2007(H... 30.2 45
gb|CY027701.1| Influenza A virus (A/Illinois/UR06-0131/2007(H... 30.2 45
gb|CY027677.1| Influenza A virus (A/Kentucky/UR06-0449/2007(H... 30.2 45
gb|CY027373.1| Influenza A virus (A/Kentucky/UR06-0424/2007(H... 30.2 45
gb|CY027485.1| Influenza A virus (A/Illinois/UR06-0115/2007(H... 30.2 45
gb|CY027469.1| Influenza A virus (A/Ohio/UR06-0394/2007(H1N1)... 30.2 45
gb|CY027437.1| Influenza A virus (A/Illinois/UR06-0094/2007(H... 30.2 45
gb|CY027421.1| Influenza A virus (A/Tennessee/UR06-0262/2007(... 30.2 45
gb|CY027397.1| Influenza A virus (A/Illinois/UR06-0136/2007(H... 30.2 45
gb|CY027357.1| Influenza A virus (A/California/UR06-0564/2007... 30.2 45
gb|CY027277.1| Influenza A virus (A/Illinois/UR06-0116/2007(H... 30.2 45
gb|CY027245.1| Influenza A virus (A/Tennessee/UR06-0124/2007(... 30.2 45
gb|CY027237.1| Influenza A virus (A/Virginia/UR06-0117/2007(H... 30.2 45
gb|CY027229.1| Influenza A virus (A/Colorado/UR06-0499/2007(H... 30.2 45
gb|CY027213.1| Influenza A virus (A/California/UR06-0585/2007... 30.2 45
gb|CY027149.1| Influenza A virus (A/North Carolina/UR06-0011/... 30.2 45
gb|CY027141.1| Influenza A virus (A/Ohio/UR06-0177/2007(H1N1)... 30.2 45
gb|CY027093.1| Influenza A virus (A/Illinois/UR06-0137/2007(H... 30.2 45
|

July 6th, 2009, 06:06 PM
|
|
Administrator, Editor
|
|
Join Date: Feb 2006
Posts: 4,768
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
thanks!
|

July 6th, 2009, 06:16 PM
|
|
Senior Moderator
|
|
Join Date: Feb 2006
Location: UK
Posts: 1,282
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
If it is YHY rather than YYY what is conferring the resistance?
|

July 6th, 2009, 06:24 PM
|
|
Resident
|
|
Join Date: May 2009
Posts: 81
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by niman
Hopes and dreams of reassorters dashed. It is swine NA, and exactly matches NJ isolate and only one difference (besides H274Y) with larger series.
|
Hmmm. Is it a recombinant? If it's a recombinant, what did it recombine with in order to acquire H274Y? If there aren't any flanking polymorphisms that are derived from a different strain, how can you tell the difference between recombination and de novo mutation?
|

July 6th, 2009, 06:47 PM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Did anyone in her family, or any traveling HK acquaintances, have a lingering seasonal H1N1 from HK - thereby setting the stage for a dual infection?
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|

July 6th, 2009, 07:00 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by JJackson
If it is YHY rather than YYY what is conferring the resistance?
|
There is only one resistant sequence (from Hong Kong). The NJ sequence matches at all other positions.
|

July 6th, 2009, 07:03 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by pjie2
Hmmm. Is it a recombinant? If it's a recombinant, what did it recombine with in order to acquire H274Y? If there aren't any flanking polymorphisms that are derived from a different strain, how can you tell the difference between recombination and de novo mutation?
|
Coincidences get very old very fast. The recombination leads to exchanges of SNPs, as described in the Nature Precedings paper. The donor sequence would be seasonal H1N1, which matches on the 3' side (like A/Indiana/1/2008).
|

July 6th, 2009, 07:07 PM
|
|
Senior Moderator
|
|
Join Date: Feb 2006
Location: UK
Posts: 1,282
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Thanks. Sorry did not read closely enough just looked at the sequences. You were just giving Jersey Girl as a close pre change relative.
|

July 6th, 2009, 07:07 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by pjie2
Hmmm. Is it a recombinant? If it's a recombinant, what did it recombine with in order to acquire H274Y? If there aren't any flanking polymorphisms that are derived from a different strain, how can you tell the difference between recombination and de novo mutation?
|
Here is the H274Y travel log (sequences that can donate H274Y)
gb|EU567011.1| Influenza A virus (A/Indiana/01/2008(H1N1)) se... 36.2 0.73
gb|DQ493078.1| Influenza A virus (A/Vietnam/CL2009/2005(H5N1)... 36.2 0.73
gb|DQ250165.1| Influenza A virus (A/Vietnam/CL2009/2005(H5N1)... 36.2 0.73
|

July 6th, 2009, 07:08 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by JJackson
Thanks. Sorry did not read closely enough just looked at the sequences. You were just giving Jersey Girl as a close pre change relative.
|
Identical pre-change in NA (also has one of the three HA polymorphisms).
|

July 6th, 2009, 07:10 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by AlaskaDenise
Did anyone in her family, or any traveling HK acquaintances, have a lingering seasonal H1N1 from HK - thereby setting the stage for a dual infection?
.
|
There is no evidence that the recombination happened in San Francisco. Pandemic H1N1 with H274Y is FIT and circulating below the radar (in MILD cases).
|

July 6th, 2009, 07:18 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by pjie2
Hmmm. Is it a recombinant? If it's a recombinant, what did it recombine with in order to acquire H274Y? If there aren't any flanking polymorphisms that are derived from a different strain, how can you tell the difference between recombination and de novo mutation?
|
The donor sequence was described last year (before the pandemic H1N1 was known)
Commentary
.
|

July 6th, 2009, 07:20 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by pjie2
Hmmm. Is it a recombinant? If it's a recombinant, what did it recombine with in order to acquire H274Y? If there aren't any flanking polymorphisms that are derived from a different strain, how can you tell the difference between recombination and de novo mutation?
|
Here is a description from last year (BEFORE pandemic H1N1 emerged)
The ability of H274Y to jump from clade to clade, as well as multiple sub-clades in 2B, as well as the rapid evolution of the 2B sub-clades, raises concerns of another vaccine mismatch, as well as the associated increase in H274Y in the H1N1 gene pool. Moreover, the match between H5N1 and the recent H1N1 isolate from Indiana raises concerns that oseltamivir resistance would develop quickly after H5N1 transmission efficiencies in humans increase, regardless of oseltamivir usage.
The rapid spread of H274Y in seasonal flu and the recent reports of increases to 100% continue to be cause for concern in seasonal and pandemic flu evolution and spread.
Commentary
.
|

July 6th, 2009, 07:25 PM
|
|
Registered User
|
|
Join Date: Apr 2009
Posts: 94
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
I know that this isn't a discussion board, so I'd like to ask Dr. Niman if he will start a thread over there to explain this to the laymen like me. It seems very important, but I don't understand anything except that the H1N1 has developed a resistance to Tamiflu? Thanks.
|

July 6th, 2009, 07:29 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by English Teacher
I know that this isn't a discussion board, so I'd like to ask Dr. Niman if he will start a thread over there to explain this to the laymen like me. It seems very important, but I don't understand anything except that the H1N1 has developed a resistance to Tamiflu? Thanks.
|
Since this is just a pseudo news thread because the media hasn't figured out that the sequences have been released, and the "experts" really don't want to talk about the sequences because this is no reassortment involving human H1N1 with H274Y and no Tamiflu to select H274Y, I think a discussion can carry this thread forward.
|

July 6th, 2009, 07:32 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by English Teacher
I know that this isn't a discussion board, so I'd like to ask Dr. Niman if he will start a thread over there to explain this to the laymen like me. It seems very important, but I don't understand anything except that the H1N1 has developed a resistance to Tamiflu? Thanks.
|
You are correct. This IS very important (and will NOT be explained in the media or by the "experts" who were "puzzled" by the H274Y in seasonal flu, and there were no lessons learned, because they are spouting the same nonsense about "random mutations" and reassortment to explain H274Y in H1N1 pandemic flu, neither of which explains the Hong Kong sequence or circumstances.
|

July 6th, 2009, 07:40 PM
|
|
Senior Moderator
|
|
Join Date: Feb 2006
Location: UK
Posts: 1,282
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by niman
There is no evidence that the recombination happened in San Francisco. Pandemic H1N1 with H274Y is FIT and circulating below the radar (in MILD cases).
|
Sorry to be lazy and pick your brains but I have not looked at the HA sequences. You say the H1N1(2009) is FIT and there are HA changes. What are you basing your fitness on? Is one of the change A193T?
|

July 6th, 2009, 07:40 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by English Teacher
I know that this isn't a discussion board, so I'd like to ask Dr. Niman if he will start a thread over there to explain this to the laymen like me. It seems very important, but I don't understand anything except that the H1N1 has developed a resistance to Tamiflu? Thanks.
|
Briefly, H274Y in H1N1 seasonal flu could not be explained by the two pillars of influenza genetics, drift by random mutation introduced by copy errors, and shifts by reassortment.
The H274Y jumped from genetic background to genetic background, eliminating reassortment, but "random errors" made no sense because there was no involvement of Tamiflu, and Tamiflu causes other resisatnce changes in H1N1 and H3N2, but all resistance was linked H274Y in H1N1. Moreover, the emergence of H274Y in the Brisbane strain (clade 2B) was linked to additional acquistions, and the key acquistions were in clade 2C (Hong Kong strain) which was co-circulating.
The acquistions in seasonal flu were detailed here
http://precedings.nature.com/documents/2832/version/1
and were due to genetic hitchhiking and recombination - and the gateway from H274Y in H5N1 and H274Y in H1N1 was the Indiana seasonal flu sequence, which was the same gateway used to move H274Y from seasonal H1N1 to pandemic (swine) H1N1.
|

July 6th, 2009, 07:43 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by JJackson
Sorry to be lazy and pick your brains but I have not looked at the HA sequences. You say the H1N1(2009) is FIT and there are HA changes. What are you basing your fitness on? Is one of the change A193T?
|
Fitness is based on infection of Hong Kong teenage who was not taking Tamiflu.
|

July 6th, 2009, 07:53 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
I have to break for tonight, and have morning meetings, so I won't be participating much until tomorrow afternoon (but not for lack of interest).
|

July 6th, 2009, 08:06 PM
|
 |
Editor-in-Chief & President
|
|
Join Date: Feb 2006
Posts: 16,778
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by English Teacher
I know that this isn't a discussion board, so I'd like to ask Dr. Niman if he will start a thread over there to explain this to the laymen like me. It seems very important, but I don't understand anything except that the H1N1 has developed a resistance to Tamiflu? Thanks.
|
We can definitely discuss the science on this thread. Thanks for asking English Teacher.
__________________
"May the long time sun
Shine upon you,
All love surround you,
And the pure light within you
Guide your way on."
"Where your talents and the needs of the world cross, lies your calling."
Aristotle
“In a gentle way, you can shake the world.”
Mohandas Gandhi
Be the light that is within.
|

July 7th, 2009, 05:12 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Tamiflu Resistant Pandemic H1N1 Sequence Released (Hong Kong)
Quote:
Originally Posted by English Teacher
I know that this isn't a discussion board, so I'd like to ask Dr. Niman if he will start a thread over there to explain this to the laymen like me. It seems very important, but I don't understand anything except that the H1N1 has developed a resistance to Tamiflu? Thanks.
|
The real gateway between H274Y on H1N1 seasonal flu and moving it to H1N1 pandmeic flu is the sequence seen in Indiana last year. It had the key change that allowed H274Y to go from H5N1 to H1N1, and that same change allows for H274Y to go from seasonal H1N1 to pandemic H1N1.
Pandemic H1N1 can also get H274Y from H5N1 and some of the new polymorphisms on H1N1 link back to H5N1, which is why pandmeic H1N1 in countries like Egypt, Indonesia, Vietnam, and India may be major problems.
|
 |
|
|
Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
|
|
|
| Thread Tools |
Search this Thread |
|
|
|
| Display Modes |
Linear Mode
|
Posting Rules
|
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts
HTML code is On
|
|
|
Disclaimer:
The reader is responsible for discerning the validity, factuality or implications of information posted here, be it fictional or based on real events. Moderators on this forum make every effort to review the material posted on this site however, it is not realistically possible for our staff to manually review each post.
The content of posts on this site, including but not limited to links to other web sites, are the expressed opinion of the original authors or posters and are not endorsed by, or representative of the opinions of, the owners or administration of this website. The posts on this website are the opinion of the specific author or poster and should not be construed as statements of advice or factual information.
Not all posts on this website are intended as truthful or factual assertion by their authors. NO posts on this website should be considered factual information on face value alone. Users are encouraged to USE DISCERNMENT and do their own follow up research while reading and posting on this website. FluTrackers.com Inc. reserves the right to make changes to, corrections and/or remove entirely at any time posts made on this website without notice. In addition, FluTrackers.com Inc. disclaims any and all liability for damages incurred directly or indirectly as a result of a post on this website.
This site is provided "as is" without warranty of any kind, either expressed or implied. You should not assume that this site is error-free or that it will be suitable for the particular purpose which you have in mind when using it. In no event shall FluTrackers.com Inc. be liable for any special, incidental, indirect or consequential damages of any kind, or any damages whatsoever, including, without limitation, those resulting from loss of use, data or profits, whether or not advised of the possibility of damage, and on any theory of liability, arising out of or in connection with the use or performance of this site or other documents which are referenced by or linked to this site.
Finally, FluTrackers.com Inc. reserves the right to delete, correct, or make changes to any post on this website without notice at any time for any reason.
Fair Use Notice:
This site may contain copyrighted material the use of which has not always been specifically authorized by the copyright owner. Users may make such material available in an effort to advance awareness and understanding of issues relating to public health, civil rights, economics, individual rights, international affairs, liberty, science & technology, etc. We believe this constitutes a 'fair use' of any such copyrighted material as provided for in section 107 of the US Copyright Law. In accordance with Title 17 U.S.C.Section 107, the material on this site is distributed to those who have expressed a prior interest in receiving the included information for research and educational purposes.
In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article. Please remember you are responsible for what you post on the internet and you could be sued by the original copyright holder if you do not honor these rules.
If you are a legal copyright holder or a designated agent for such and you believe a post on this website falls outside the boundaries of "Fair Use" and legitimately infringes on yours or your clients copyright
we may be contacted concerning copyright matters at:
FluTrackers.com Inc.
c/o Sharon Sanders
1676 Hibiscus Avenue
Winter Park, Florida 32789
Phone: 407-406-3037
E-Mail: flutrackers@earthlink.net
In accordance with section 512 of the U.S. Copyright Act our contact information has been registered with the United States Copyright Office. "Safe Harbor" noticing procedures as outlined in the DMCA apply to this website concerning all 3rd party posts published herein.
If notice is given of an alleged copyright violation we will act expeditiously to remove or disable access to the material(s) in question.
All 3rd party material posted on this website is the copyright of the respective owners / authors. FluTrackers.com Inc. makes no claim of copyright on such material.
For more information please visit:
http://www.law.cornell.edu/uscode/17/107.shtml
Please be aware any communications sent complaining about a post on this website may be posted publicly at the discretion of the administration.
FluTrackers Does Not Provide Any Medical Advice:
FluTrackers, Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster.
The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website.
By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
By using and/or accessing this site, either passively or actively, you are agreeing to all of the above conditions. Also, by using and/or accessing this site, either passively or actively, you agree to conduct all business and legal affairs related to this website in the jurisdiction of Flutrackers.com Inc. which is registered in Central Florida, USA.
These Disclaimers are subject to change at anytime.
Email the Webmaster with questions or comments about this site at flutrackers@earthlink.net
All times are GMT -4. The time now is 05:17 PM.
|