 |
|
June 11th, 2007, 02:39 PM
|
 |
Editor, Senior Moderator
|
|
Join Date: Aug 2006
Location: Netherlands
Posts: 10,613
|
|
Four-year-old Egyptian girl has bird flu
Four-year-old Egyptian girl has bird flu
11 Jun 2007 18:08:30 GMT
Source: Reuters
CAIRO, June 11 (Reuters) - A four-year-old girl has contracted the bird flu virus in southern Egypt, the 36th case among humans in the Arab world's most populous country, the Health Ministry said on Monday.
Fifteen of Egypt's bird flu cases have proven fatal.
Dina Ali Taghyan from Abu Diyab village in Qena province was admitted to hospital on Sunday with a high temperature, pneumonia and difficulty breathing, and had been exposed to birds suspected of having bird flu, the ministry said.
She was taken to a hospital in the capital Cairo and is in a stable condition under treatment, it added in a statement.
She is the second case in Egypt in two weeks after a lull of nearly two months. Egyptian officials had said they expected the virus to lie low during the hot summer, following the pattern it set last year after the initial outbreak in February 2006.
The other recent case, a 10-year-old girl also from Qena, died in hospital on Saturday. Delays in reporting and diagnosing her infection may have contributed to her death.
Bird flu did extensive damage to the country's poultry industry and the economy as a whole after its arrival in Egypt, which has more confirmed bird flu cases among humans than any other country outside of Asia.
Most of those who have fallen ill in Egypt were reported to have had contact with sick or dead household birds, primarily in northern Egypt where the weather is cooler than in the south.
But in a sign of a change in how the disease may be occurring in Egypt, all but two of the past 12 human cases have occurred in central or southern parts of the country.
Around five million households in Egypt depend on poultry as a main source of food and income and the government has said this makes it unlikely the disease can be eradicated. The government still finds it hard to enforce restrictions on the movement and sale of live poultry.
http://www.alertnet.org/thenews/newsdesk/L11827375.htm
|
June 11th, 2007, 03:01 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
This case is just north of Qena. 10F was just south (both on Nile).
|
June 11th, 2007, 03:44 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
Sequence from 10F is clearly evolving.
|
June 11th, 2007, 04:09 PM
|
|
Senior Moderator
|
|
Join Date: Jul 2006
Posts: 1,007
|
|
Re: Four-year-old Egyptian girl has bird flu
have you seen the sequences, D. Niman ?
|
June 11th, 2007, 05:02 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
N98D in London in 1918.
|
June 11th, 2007, 05:16 PM
|
|
Senior User
|
|
Join Date: Oct 2006
Posts: 384
|
|
Re: Four-year-old Egyptian girl has bird flu
whats N98D in london mean, dr Niman if you dont mind me asking,thank you.
|
June 11th, 2007, 05:35 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
Quote:
Originally Posted by vinny
whats N98D in london mean, dr Niman if you dont mind me asking,thank you.
|
The N at position 98 changed to D
Also in
South Carloina in 1918
New York in 1918
Brevig Mission in 1918
London in 1919
|
June 11th, 2007, 05:50 PM
|
 |
Editor, Advisory Board, Senior Moderator
|
|
Join Date: Feb 2006
Posts: 2,579
|
|
Re: Four-year-old Egyptian girl has bird flu
Dr. Niman are you suggesting this is a critical move towards adaptation to a human host or perhaps moving in that direction because it was present in the pandemic virus of 1918?
__________________
Please do not ask me for medical advice, I am not a medical doctor.
Avatar is a painting by Alan Pollack, titled, "Plague". I'm sure it was an accident that the plague girl happens to look almost like my twin.
|
June 11th, 2007, 05:56 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
Quote:
Originally Posted by Shannon
Dr. Niman are you suggesting this is a critical move towards adaptation to a human host or perhaps moving in that direction because it was present in the pandemic virus of 1918?
|
Its a mammalian move. Here is one travel log for the amino acid change
|
June 11th, 2007, 06:00 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
Quote:
Originally Posted by Shannon
Dr. Niman are you suggesting this is a critical move towards adaptation to a human host or perhaps moving in that direction because it was present in the pandemic virus of 1918?
|
Code:
DQ356886 A/chicken/Anhui/M HA (4) 1038 H5N1
AY834279 A/tiger/Thailand/SPB-1 HA (4) 1779 H5N1
EF535822 A/Egypt/2321-NAMRU3/2007 HA (4) 1730 2007 H5N1
EF535823 A/Egypt/2331-NAMRU3/2007 HA (4) 1730 2007 H5N1
EF535824 A/Egypt/2616-NAMRU3/2007 HA (4) 1730 2007 H5N1
EF535825 A/Egypt/2620-NAMRU3/2007 HA (4) 1730 2007 H5N1
DQ643982 A/cat/Germany/606/2006 HA (4) 1779 2006 H5N1
AM403468 A/cat/Germany/R606/06 HA (4) 1707 2006 H5N1
DQ992772 A/chicken/Guiyang/1218/2006 HA (4) 1668 2006 H5N1
DQ992991 A/chicken/Guiyang/1655/2006 HA (4) 1062 2006 H5N1
DQ992911 A/chicken/Guiyang/207/2006 HA (4) 1044 2006 H5N1
DQ992912 A/chicken/Guiyang/217/2006 HA (4) 1002 2006 H5N1
DQ992913 A/chicken/Guiyang/237/2006 HA (4) 1044 2006 H5N1
DQ992766 A/chicken/Guiyang/441/2006 HA (4) 1668 2006 H5N1
DQ992769 A/chicken/Guiyang/846/2006 HA (4) 1698 2006 H5N1
DQ993056 A/chicken/Hunan/2246/2006 HA (4) 1017 2006 H5N1
DQ993057 A/chicken/Hunan/2292/2006 HA (4) 1074 2006 H5N1
DQ914814 A/chicken/Shanxi/2/2006 HA (4) 1779 2006 H5N1
DQ999880 A/chicken/Thailand/PC-168/2006 HA (4) 1710 2006 H5N1
DQ999887 A/chicken/Thailand/PC-170/2006 HA (4) 1718 2006 H5N1
DQ993020 A/duck/Guiyang/1129/2006 HA (4) 1062 2006 H5N1
DQ992918 A/duck/Guiyang/504/2006 HA (4) 1065 2006 H5N1
DQ992920 A/duck/Guiyang/523/2006 HA (4) 1047 2006 H5N1
ISDN230178 A/Duck/Vietnam/Tien Giang 409/2006 HA (4) 1739 2006 H5N1
DQ992771 A/goose/Guiyang/1175/2006 HA (4) 1668 2006 H5N1
DQ992979 A/goose/Guiyang/1325/2006 HA (4) 1062 2006 H5N1
DQ992765 A/goose/Guiyang/337/2006 HA (4) 1668 2006 H5N1
ISDN230179 A/Muscovy Duck/Vietnam/Ben Tre 342/2006 HA (4) 1736 2006 H5N1
ISDN121986 A/Cambodia/JP52a/2005 HA (4) 1707 2005 H5N1
EF456805 A/Cambodia/JP52a/2005 HA (4) 1707 2005 H5N1
EF473073 A/chicken/Cambodia/013LC1b/2005 HA (4) 1659 2005 H5N1
ISDN122143 A/chicken/Cambodia/013LC1b/2005 HA (4) 1659 2005 H5N1
EF473074 A/chicken/Cambodia/022LC3b/2005 HA (4) 1657 2005 H5N1
ISDN122146 A/chicken/Cambodia/022LC3b/2005 HA (4) 1657 2005 H5N1
DQ343150 A/chicken/Hebei/326/2005 HA (4) 1707 2005 H5N1
EF582401 A/chicken/Kamphaengphet/NIAH6-3-0011/2005 HA (4) 1702 2005 H5N1
EF582403 A/chicken/Kamphaengphet/NIAH6-3-0013/2005 HA (4) 1635 2005 H5N1
EF582404 A/chicken/Kamphaengphet/NIAH6-3-0014/2005 HA (4) 1589 2005 H5N1
EF582405 A/chicken/Kamphaengphet/NIAH6-3-0015/2005 HA (4) 1301 2005 H5N1
EF582406 A/chicken/Phitsanulok/NIAH6-3-0011/2005 HA (4) 1664 2005 H5N1
EF582407 A/chicken/Phitsanulok/NIAH6-3-0017/2005 HA (4) 1648 2005 H5N1
EF582408 A/chicken/Sukhothai/NIAH6-3-0018/2005 HA (4) 1704 2005 H5N1
DQ153251 A/chicken/Thailand/Kamphaengphet-3-01/2005 HA (4) 1075 2005 H5N1
DQ153252 A/chicken/Thailand/Kamphaengphet-3-02/2005 HA (4) 1104 2005 H5N1
DQ251796 A/chicken/Thailand/Kamphaengphet-3-03/2005 HA (4) 1104 2005 H5N1
DQ251797 A/chicken/Thailand/Kamphaengphet-3-04/2005 HA (4) 1107 2005 H5N1
DQ251798 A/chicken/Thailand/Kamphaengphet-3-05/2005 HA (4) 1074 2005 H5N1
DQ251799 A/chicken/Thailand/Kamphaengphet-3-06/2005 HA (4) 1107 2005 H5N1
DQ251800 A/chicken/Thailand/Kamphaengphet-3-07/2005 HA (4) 1068 2005 H5N1
DQ334760 A/chicken/Thailand/Kanchanaburi/CK-160/2005 HA (4) 1761 2005 H5N1
DQ334776 A/chicken/Thailand/Nontaburi/CK-162/2005 HA (4) 1726 2005 H5N1
EF582402 A/chicken/Uthaiyhani/NIAH6-3-0012/2005 HA (4) 1320 2005 H5N1
CY016875 A/chicken/Viet Nam/11/2005 HA (4) 1731 2005 H5N1
CY016835 A/chicken/Viet Nam/2/2005 HA (4) 1731 2005 H5N1
CY016843 A/chicken/Viet Nam/6/2005 HA (4) 1729 2005 H5N1
CY016851 A/chicken/Viet Nam/8/2005 HA (4) 1741 2005 H5N1
CY016859 A/chicken/Viet Nam/9/2005 HA (4) 1731 2005 H5N1
ISDN124038 A/Chicken/Viet Nam/NCVD09/2005 HA (4) 1707 2005 H5N1
EF566200 A/Chicken/Viet Nam/NCVD09/2005 HA (4) 1707 2005 H5N1
EF566199 A/Chicken/Viet Nam/NCVD10/2005 HA (4) 1709 2005 H5N1
ISDN124037 A/Chicken/Viet Nam/NCVD10/2005 HA (4) 1709 2005 H5N1
EF566198 A/Chicken/Viet Nam/NCVD12/2005 HA (4) 1709 2005 H5N1
DQ497676 A/chicken/Vietnam/348/2005 HA (4) 1692 2005 H5N1
DQ497712 A/chicken/Vietnam/393/2005 HA (4) 1695 2005 H5N1
DQ497703 A/chicken/Vietnam/398/2005 HA (4) 1695 2005 H5N1
ISDN230181 A/Chicken/Vietnam/Binh Duong477/2005 HA (4) 1729 2005 H5N1
ISDN128307 A/chicken/Vietnam/G62/05 HA (4) 1704 2005 H5N1
AM183674 A/chicken/Vietnam/P22/05 HA (4) 1776 2005 H5N1
AM183672 A/chicken/Vietnam/P41/05 HA (4) 1776 2005 H5
AM183673 A/chicken/Vietnam/P78/05 HA (4) 1776 2005 H5
ISDN128308 A/chicken/Vietnam/TY9/05 HA (4) 1704 2005 H5N1
EF208917 A/chicken/West Java/Smihay1/2005 HA (4) 1087 2005 H5N1
DQ992753 A/duck/Guiyang/2231/2005 HA (4) 1644 2005 H5N1
EF582399 A/duck/Uthaithani/NIAH6-3-0008/2005 HA (4) 1655 2005 H5N1
CY016827 A/duck/Viet Nam/1/2005 HA (4) 1731 2005 H5N1
CY017067 A/duck/Viet Nam/18/2005 HA (4) 1731 2005 H5N1
CY017187 A/duck/Viet Nam/19/2005 HA (4) 1731 2005 H5N1
CY016891 A/duck/Viet Nam/20/2005 HA (4) 1731 2005 H5N1
EF566215 A/Duck/Viet Nam/367/2005 HA (4) 1733 2005 H5N1
ISDN124623 A/Duck/Viet Nam/367/2005 HA (4) 1733 2005 H5N1
ISDN124044 A/Duck/Viet Nam/NCVD01/2005 HA (4) 1710 2005 H5N1
EF566203 A/Duck/Viet Nam/NCVD01/2005 HA (4) 1710 2005 H5N1
ISDN124040 A/Duck/Viet Nam/NCVD04/2005 HA (4) 1727 2005 H5N1
EF566201 A/Duck/Viet Nam/NCVD04/2005 HA (4) 1727 2005 H5N1
ISDN124142 A/Duck/Viet Nam/NCVD05/2005 HA (4) 1729 2005 H5N1
EF566204 A/Duck/Viet Nam/NCVD05/2005 HA (4) 1729 2005 H5N1
EF566197 A/Duck/Viet Nam/NCVD06/2005 HA (4) 1707 2005 H5N1
ISDN124035 A/Duck/Viet Nam/NCVD06/2005 HA (4) 1707 2005 H5N1
ISDN124032 A/Duck/Viet Nam/NCVD07/2005 HA (4) 1726 2005 H5N1
EF566196 A/Duck/Viet Nam/NCVD07/2005 HA (4) 1726 2005 H5N1
EF566195 A/Duck/Viet Nam/NCVD08/2005 HA (4) 1724 2005 H5N1
ISDN124030 A/Duck/Viet Nam/NCVD08/2005 HA (4) 1724 2005 H5N1
DQ497674 A/duck/Vietnam/272/2005 HA (4) 1692 2005 H5N1
DQ497708 A/duck/Vietnam/283/2005 HA (4) 1695 2005 H5N1
DQ497697 A/duck/Vietnam/286/2005 HA (4) 1695 2005 H5N1
DQ497689 A/duck/Vietnam/317/2005 HA (4) 1692 2005 H5N1
DQ497704 A/duck/Vietnam/376/2005 HA (4) 1695 2005 H5N1
ISDN128302 A/duck/Vietnam/5001/05 HA (4) 1704 2005 H5N1
ISDN128303 A/duck/Vietnam/5003/05 HA (4) 1704 2005 H5N1
ISDN128304 A/duck/Vietnam/5004/05 HA (4) 1704 2005 H5N1
ISDN128305 A/duck/Vietnam/5082/05 HA (4) 1704 2005 H5N1
DQ497717 A/duck/Vietnam/543/2005 HA (4) 1695 2005 H5N1
DQ497709 A/duck/Vietnam/557/2005 HA (4) 1695 2005 H5N1
AM183676 A/duck/Vietnam/AG40-O2/05 HA (4) 1479 2005 H5
ISDN230188 A/Duck/Vietnam/An Giang 680B/2005 HA (4) 1731 2005 H5N1
ISDN230189 A/Duck/Vietnam/Dong Thap 680A/2005 HA (4) 1736 2005 H5N1
ISDN230186 A/Duck/Vietnam/Dong Thap 680D/2005 HA (4) 1709 2005 H5N1
ISDN230182 A/Duck/Vietnam/Dong Thap 680H/2005 HA (4) 1730 2005 H5N1
ISDN230185 A/Duck/Vietnam/Hau Giang680E/2005 HA (4) 1696 2005 H5N1
ISDN230184 A/Duck/Vietnam/Hau Giang680F/2005 HA (4) 1729 2005 H5N1
DQ497688 A/duck/Vietnam/N-TB/2005 HA (4) 1692 2005 H5N1
DQ497694 A/duck/Vietnam/S640/2005 HA (4) 1695 2005 H5N1
DQ497699 A/duck/Vietnam/S649/2005 HA (4) 693 2005 H5N1
DQ320936 A/duck/Vietnam/S654/2005 HA (4) 1698 2005 H5N1
ISDN230187 A/Duck/Vietnam/Soc Trang 680C/2005 HA (4) 1731 2005 H5N1
AM183677 A/duck/Vietnam/TG24-O1/05 HA (4) 1776 2005 H5N1
AM183675 A/duck/Vietnam/TG36-H2/05 HA (4) 1479 2005 H5
ISDN122147 A/goose/Cambodia/022b/2005 HA (4) 1659 2005 H5N1
EF473075 A/goose/Cambodia/022b/2005 HA (4) 1659 2005 H5N1
DQ992794 A/goose/Yunnan/3315/2005 HA (4) 1689 2005 H5N1
DQ992941 A/goose/Yunnan/3644/2005 HA (4) 1062 2005 H5N1
ISDN129400 A/Hanoi/30408/2005 HA (4) 1776 2005 H5N1
AB239125 A/Hanoi/30408/2005 HA (4) 1776 2005 H5N1
DQ497675 A/mallard/Vietnam/347/2005 HA (4) 1692 2005 H5N1
DQ497677 A/mallard/Vietnam/352/2005 HA (4) 1692 2005 H5N1
ISDN124042 A/Muscovy Duck/Viet Nam/NCVD02/2005 HA (4) 1735 2005 H5N1
EF566202 A/Muscovy Duck/Viet Nam/NCVD02/2005 HA (4) 1735 2005 H5N1
DQ334768 A/quail/Thailand/Nakhon Pathom/QA-161/2005 HA (4) 1726 2005 H5N1
DQ497711 A/quail/Vietnam/282/2005 HA (4) 1695 2005 H5N1
EF208915 A/quail/West Java/smijjg2/2005 HA (4) 1074 2005 H5N1
DQ360835 A/Thailand/676/2005 HA (4) 1725 2005 H5N1
DQ885618 A/Thailand/HA20/2005 HA (4) 1686 2005 H5N1
DQ372591 A/Thailand/NK165/2005 HA (4) 1713 2005 H5N1
DQ885610 A/Thailand/NKFEHA/2005 HA (4) 1711 2005 H5N1
DQ885612 A/Thailand/NKNPHA/2005 HA (4) 1670 2005 H5N1
DQ885614 A/Thailand/RPFEHA/2005 HA (4) 1698 2005 H5N1
DQ885616 A/Thailand/RPNPHA/2005 HA (4) 1655 2005 H5N1
EF456803 A/Viet Nam/HN30408/2005 HA (4) 1704 2005 H5N1
ISDN119678 A/Viet Nam/HN30408/2005 HA (4) 1704 2005 H5N1
ISDN117778 A/Viet Nam/JP14/2005 HA (4) 1707 2005 H5N1
EF456799 A/Viet Nam/JP14/2005 HA (4) 1707 2005 H5N1
ISDN117777 A/Viet Nam/JP4207/2005 HA (4) 1707 2005 H5N1
EF456798 A/Viet Nam/JP4207/2005 HA (4) 1707 2005 H5N1
DQ497726 A/Vietnam/CL105/2005 HA (4) 1689 2005 H5N1
DQ535724 A/Vietnam/PEV16T/2005 HA (4) 1533 2005 H5N1
DQ497705 A/wild bird/Vietnam/434/2005 HA (4) 1695 2005 H5N1
ISDN124036 AChicken/Viet Nam/NCVD12/2005 HA (4) 1709 2005 H5N1
DQ188905 A/babbler/Fujian/320/04 HA (4) 1071 2004 H5N1
AY651330 A/bird/Thailand/3.1/2004 HA (4) 1697 2004 H5N1
AY741213 A/blackbird/Hunan/1/2004 HA (4) 1707 2004 H5N1
DQ236077 A/cat/Thailand/KU-02/04 HA (4) 1712 2004 H5N1
AY770991 A/chicken/Ayutthaya/Thailand/CU-23/04 HA (4) 1711 2004 H5N1
DQ083569 A/chicken/Ayutthaya/Thailand/CU-24/04 HA (4) 1650 2004 H5N1
DQ083568 A/chicken/Bangkok/Thailand/CU-20/04 HA (4) 1666 2004 H5N1
DQ083551 A/chicken/Bangkok/Thailand/CU-3/04 HA (4) 1712 2004 H5N1
DQ083554 A/chicken/Bangkok/Thailand/CU-6/04 HA (4) 1666 2004 H5N1
EF473068 A/chicken/Cambodia/1/2004 HA (4) 998 2004 H5N1
ISDN40864 A/chicken/Cambodia/1/2004 HA (4) 998 2004 H5N1
ISDN49117 A/chicken/Cambodia/7/2004 HA (4) 1662 2004 H5N1
EF473069 A/chicken/Cambodia/7/2004 HA (4) 1662 2004 H5N1
DQ083558 A/chicken/Chachoengsao/Thailand/CU-10/04 HA (4) 1666 2004 H5N1
DQ083559 A/chicken/Chachoengsao/Thailand/CU-11/04 HA (4) 1670 2004 H5N1
DQ083555 A/chicken/Chonburi/Thailand/CU-7/04 HA (4) 1668 2004 H5N1
DQ083580 A/chicken/Chonburi/Thailand/CU-73/04 HA (4) 1667 2004 H5N1
DQ080022 A/chicken/Henan/01/2004 HA (4) 1748 2004 H5N1
AY950230 A/chicken/Henan/1/2004 HA (4) 1779 2004 H5N1
AY950232 A/chicken/Henan/12/2004 HA (4) 1779 2004 H5N1
AY950233 A/chicken/Henan/13/2004 HA (4) 1779 2004 H5N1
AY950234 A/chicken/Henan/16/2004 HA (4) 1779 2004 H5N1
AY950231 A/chicken/Henan/210/2004 HA (4) 1779 2004 H5N1
DQ997219 A/chicken/Henan/wu/2004 HA (4) 1779 2004 H5N1
ISDN48972 A/Chicken/Hu bei/14/2004 HA (4) 1779 2004 H5N1
AY684706 A/chicken/Hubei/327/2004 HA (4) 1779 2004 H5N1
AY770079 A/chicken/Hubei/489/2004 HA (4) 1779 2004 H5N1
DQ997396 A/chicken/Hunan/fg/2004 HA (4) 1351 2004 H5N1
AY653200 A/chicken/Jilin/9/2004 HA (4) 1779 2004 H5N1
DQ997325 A/chicken/Jilin/hk/2004 HA (4) 1779 2004 H5N1
DQ017270 A/chicken/Kamphaengphet-2-01/2004 HA (4) 1080 2004 H5N1
DQ017308 A/chicken/Kamphaengphet-2-02/2004 HA (4) 1100 2004 H5N1
DQ017274 A/chicken/Kamphaengphet-2-03/2004 HA (4) 1093 2004 H5N1
DQ017304 A/chicken/Kamphaengphet-2-04/2004 HA (4) 1100 2004 H5N1
DQ017297 A/chicken/Kamphaengphet-2-05/2004 HA (4) 1094 2004 H5N1
DQ017275 A/chicken/Kamphaengphet-2-06/2004 HA (4) 1093 2004 H5N1
ISDN40925 A/Chicken/Laos/44/2004 HA (4) 1741 2004 H5N1
EF541415 A/chicken/Laos/44/2004 HA (4) 1741 2004 H5N1
EF541413 A/chicken/Laos/7191/2004 HA (4) 1741 2004 H5N1
ISDN40922 A/Chicken/Laos/7191/2004 HA (4) 1741 2004 H5N1
ISDN40923 A/Chicken/Laos/7192/2004 HA (4) 1741 2004 H5N1
EF541414 A/chicken/Laos/7192/2004 HA (4) 1741 2004 H5N1
DQ083576 A/chicken/Lopburi/Thailand/CU-38/04 HA (4) 1668 2004 H5N1
AY830774 A/chicken/Macheng/2004 HA (4) 1707 2004 H5N1
ISDN80767 A/chicken/Malaysia/5858/04 HA (4) 1696 2004 H5N1
DQ320934 A/chicken/Malaysia/5858/2004 HA (4) 1695 2004 H5N1
DQ083562 A/chicken/Nakhon Pathom/Thailand/CU-14/04 HA (4) 1649 2004 H5N1
DQ083560 A/chicken/Nakhon Sawan/Thailand/CU-12/04 HA (4) 1649 2004 H5N1
DQ083561 A/chicken/Nakhon Sawan/Thailand/CU-13/04 HA (4) 1638 2004 H5N1
DQ083577 A/chicken/Nakhon Sawan/Thailand/CU-39/04 HA (4) 1664 2004 H5N1
AY590575 A/chicken/Nakorn-Patom/Thailand/CU-K3/2004 HA (4) 400 2004 H5N1
DQ017290 A/chicken/Nakornsawan-2-01/2004 HA (4) 1100 2004 H5N1
DQ017301 A/chicken/Nakornsawan-2-02/2004 HA (4) 1092 2004 H5N1
DQ017271 A/chicken/Nakornsawan-2-04/2004 HA (4) 1094 2004 H5N1
DQ017294 A/chicken/Nakornsawan-2-05/2004 HA (4) 1094 2004 H5N1
DQ017302 A/chicken/Nakornsawan-2-06/2004 HA (4) 1094 2004 H5N1
DQ017299 A/chicken/Phetchabun-2-01/2004 HA (4) 1100 2004 H5N1
DQ017292 A/chicken/Phetchabun-2-02/2004 HA (4) 937 2004 H5N1
DQ017298 A/chicken/Phitsanulok-2-01/2004 HA (4) 1094 2004 H5N1
DQ017295 A/chicken/Phitsanulok-2-02/2004 HA (4) 1094 2004 H5N1
DQ017283 A/chicken/Phitsanulok-2-03/2004 HA (4) 1093 2004 H5N1
DQ017291 A/chicken/Phitsanulok-2-04/2004 HA (4) 1093 2004 H5N1
DQ083582 A/chicken/Prachinburi/Thailand/CU-104/04 HA (4) 1647 2004 H5N1
DQ083556 A/chicken/Prachinburi/Thailand/CU-8/04 HA (4) 1656 2004 H5N1
DQ083578 A/chicken/Ratchaburi/Thailand/CU-68/04 HA (4) 1717 2004 H5N1
DQ083565 A/chicken/Saraburi/Thailand/CU-17/04 HA (4) 1713 2004 H5N1
DQ083572 A/chicken/Saraburi/Thailand/CU-27/04 HA (4) 1668 2004 H5N1
DQ767725 A/chicken/Shandong/K01/2004 HA (4) 1779 2004 H5N1
DQ017277 A/chicken/Sukhothai-2-01/2004 HA (4) 1068 2004 H5N1
DQ017276 A/chicken/Sukhothai-2-02/2004 HA (4) 1093 2004 H5N1
DQ083550 A/chicken/Suphanburi/Thailand/CU-1/04 HA (4) 1700 2004 H5N1
EF467802 A/chicken/Thailand/2/04 HA (4) 1720 2004 H5N1
ISDN49021 A/chicken/Thailand/2/04 HA (4) 1720 2004 H5N1
DQ076201 A/Chicken/Thailand/73/2004 HA (4) 1730 2004 H5N1
AY651327 A/Chicken/Thailand/73/2004 HA (4) 1697 2004 H5N1
AY553805 A/chicken/Thailand/Bangkok-01/2004 HA (4) 1057 2004 H5N1
AY553806 A/chicken/Thailand/Bangkok-02/2004 HA (4) 1045 2004 H5N1
AY649382 A/chicken/Thailand/CH-2/2004 HA (4) 1708 2004 H5N1
AY779050 A/chicken/Thailand/CU-21/2004 HA (4) 1680 2004 H5N1
AY553796 A/chicken/Thailand/Kamphaengphet-01/2004 HA (4) 1099 2004 H5N1
AY553811 A/chicken/Thailand/Khonkaen-01/2004 HA (4) 913 2004 H5N1
AY553810 A/chicken/Thailand/Mahasarakham-01/2004 HA (4) 1079 2004 H5N1
AY552000 A/chicken/Thailand/Nakornsawan-01/2004 HA (4) 1098 2004 H5N1
AY553798 A/chicken/Thailand/Nakornsawan-02/2004 HA (4) 1100 2004 H5N1
AY553804 A/chicken/Thailand/Pathumthani-01/2004 HA (4) 1049 2004 H5N1
AY553799 A/chicken/Thailand/Phetchabun-01/2004 HA (4) 1100 2004 H5N1
AY553800 A/chicken/Thailand/Phetchabun-02/2004 HA (4) 1096 2004 H5N1
AY553795 A/chicken/Thailand/Phichit-01/2004 HA (4) 1098 2004 H5N1
AY553784 A/chicken/Thailand/Phitsanulok-01/2004 HA (4) 1103 2004 H5N1
AY553793 A/chicken/Thailand/Phitsanulok-02/2004 HA (4) 1066 2004 H5N1
AY553794 A/chicken/Thailand/Phitsanulok-03/2004 HA (4) 1089 2004 H5N1
AY553785 A/chicken/Thailand/Sukhothai-01/2004 HA (4) 1088 2004 H5N1
AY553801 A/chicken/Thailand/Sukhothai-02/2004 HA (4) 1087 2004 H5N1
AY552001 A/chicken/Thailand/Tak-01/2004 HA (4) 1094 2004 H5N1
AY553807 A/chicken/Thailand/Udonthani-01/2004 HA (4) 1079 2004 H5N1
AY553808 A/chicken/Thailand/Udonthani-02/2004 HA (4) 1064 2004 H5N1
AY553809 A/chicken/Thailand/Udonthani-03/2004 HA (4) 1079 2004 H5N1
AY553790 A/chicken/Thailand/Uthaithani-01/2004 HA (4) 1094 2004 H5N1
AY553788 A/chicken/Thailand/Uttaradit-01/2004 HA (4) 1079 2004 H5N1
AY553789 A/chicken/Thailand/Uttaradit-02/2004 HA (4) 1100 2004 H5N1
EF593102 A/chicken/Thailand/vsmu-3-BKK/2004 HA (4) 1708 2004 H5N1
DQ017296 A/chicken/Uthaithani-2-01/2004 HA (4) 1094 2004 H5N1
DQ017293 A/chicken/Uthaithani-2-02/2004 HA (4) 1087 2004 H5N1
DQ017289 A/chicken/Uthaithani-2-03/2004 HA (4) 1079 2004 H5N1
DQ017287 A/chicken/Uthaithani-2-04/2004 HA (4) 1060 2004 H5N1
DQ017278 A/chicken/Uthaithani-2-05/2004 HA (4) 1085 2004 H5N1
DQ017281 A/chicken/Uttaradit-2-01/2004 HA (4) 1093 2004 H5N1
DQ017282 A/chicken/Uttaradit-2-02/2004 HA (4) 1094 2004 H5N1
DQ017279 A/chicken/Uttaradit-2-03/2004 HA (4) 1100 2004 H5N1
ISDN40909 A/Chicken/Viet Nam/1/2004 HA (4) 1741 2004 H5N1
EF541409 A/chicken/Viet Nam/1/2004 HA (4) 1741 2004 H5N1
AY651343 A/Chicken/Viet Nam/C57/2004 HA (4) 1697 2004 H5N1
DQ099759 A/chicken/Viet Nam/DT-171/2004 HA (4) 1707 2004 H5N1
AY728894 A/chicken/Viet Nam/HauGiang-617/2004 HA (4) 1395 2004 H5N1
AY724783 A/chicken/Viet Nam/HCM-022/2004 HA (4) 870 2004 H5N1
DQ099760 A/chicken/Viet Nam/LD-080/2004 HA (4) 1707 2004 H5N1
ISDN38693 A/Chicken/Viet Nam/Ncvd31/2004 HA (4) 1741 2004 H5N1
EF541406 A/chicken/Viet Nam/Ncvd31/2004 HA (4) 1741 2004 H5N1
DQ099758 A/chicken/Viet Nam/TG-023/2004 HA (4) 1707 2004 H5N1
DQ099755 A/chicken/Viet Nam/TN-025/2004 HA (4) 1707 2004 H5N1
AY724787 A/chicken/Viet Nam/VL-008/2004 HA (4) 1081 2004 H5N1
DQ497718 A/chicken/Vietnam/132/2004 HA (4) 1695 2004 H5N1
DQ497700 A/chicken/Vietnam/133/2004 HA (4) 1695 2004 H5N1
DQ497714 A/chicken/Vietnam/134/2004 HA (4) 1695 2004 H5N1
DQ497695 A/chicken/Vietnam/135/2004 HA (4) 1695 2004 H5N1
DQ497701 A/chicken/Vietnam/147/2004 HA (4) 1695 2004 H5N1
DQ497696 A/chicken/Vietnam/149/2004 HA (4) 1695 2004 H5N1
DQ497713 A/chicken/Vietnam/159/2004 HA (4) 1695 2004 H5N1
DQ497706 A/chicken/Vietnam/260/2004 HA (4) 1692 2004 H5N1
DQ497687 A/chicken/Vietnam/32/2004 HA (4) 1692 2004 H5N1
DQ497698 A/chicken/Vietnam/52/2004 HA (4) 1695 2004 H5N1
DQ497710 A/chicken/Vietnam/53/2004 HA (4) 1695 2004 H5N1
AY818136 A/chicken/Vietnam/C58/04 HA (4) 1707 2004 H5N1
AY576927 A/Chicken/Vietnam/CM/2004 HA (4) 1430 2004 H5N1
DQ320937 A/chicken/Vietnam/DT171/2004 HA (4) 1696 2004 H5N1
ISDN128306 A/chicken/Vietnam/G04/04 HA (4) 1707 2004 H5N1
AY574187 A/chicken/Vietnam/HD1/2004 HA (4) 1521 2004 H5N1
AY574190 A/chicken/Vietnam/HD2/2004 HA (4) 1346 2004 H5N1
AY623430 A/chicken/Yichang/lung-1/04 HA (4) 1517 2004 H5N1
AY651326 A/Ck/Thailand/1/2004 HA (4) 1701 2004 H5N1
AY651328 A/Ck/Thailand/9.1/2004 HA (4) 1697 2004 H5N1
AY651337 A/Ck/Viet Nam/33/2004 HA (4) 1683 2004 H5N1
AY651338 A/Ck/Viet Nam/35/2004 HA (4) 1697 2004 H5N1
AY651339 A/Ck/Viet Nam/36/2004 HA (4) 1697 2004 H5N1
AY651340 A/Ck/Viet Nam/37/2004 HA (4) 1697 2004 H5N1
AY651341 A/Ck/Viet Nam/38/2004 HA (4) 1697 2004 H5N1
AY651342 A/Ck/Viet Nam/39/2004 HA (4) 1696 2004 H5N1
DQ182483 A/crested eagle/Belgium/01/2004 HA (4) 1707 2004 H5N1
DQ083563 A/crow/Bangkok/Thailand/CU-15/04 HA (4) 1710 2004 H5N1
DQ083570 A/crow/Bangkok/Thailand/CU-25/04 HA (4) 1648 2004 H5N1
DQ083575 A/crow/Bangkok/Thailand/CU-35/04 HA (4) 1645 2004 H5N1
DQ083552 A/crow/Bangkok/Thailand/CU-4/04 HA (4) 1697 2004 H5N1
DQ191689 A/curlew/Shandong/61/04 HA (4) 841 2004 H5N1
AY651331 A/Dk/Thailand/71.1/2004 HA (4) 1697 2004 H5N1
AY651344 A/Dk/Viet Nam/11/2004 HA (4) 1696 2004 H5N1
DQ530173 A/dog/Thailand-Suphanburi/KU-08/04 HA (4) 1704 2004 H5N1
DQ104701 A/duck broiler/Malaysia/F118/08/04 HA (4) 1733 2004 H5N2
DQ122147 A/duck broiler/Malaysia/F189/07/04 HA (4) 1733 2004 H5N2
DQ083553 A/duck/Chonburi/Thailand/CU-5/04 HA (4) 1697 2004 H5N1
DQ083579 A/duck/Nakhon Pathom/Thailand/CU-71/04 HA (4) 1700 2004 H5N1
DQ017300 A/duck/Nakornsawan-2-02/2004 HA (4) 1093 2004 H5N1
DQ017284 A/duck/Phichit-2-01/2004 HA (4) 1093 2004 H5N1
DQ017285 A/duck/Phichit-2-02/2004 HA (4) 1093 2004 H5N1
DQ017272 A/duck/Phitsanulok-2-01/2004 HA (4) 1094 2004 H5N1
DQ017286 A/duck/Phitsanulok-2-02/2004 HA (4) 1094 2004 H5N1
EF582396 A/duck/Phitsanulok/NIAH6-2-0042/2004 HA (4) 1566 2004 H5N1
EF582398 A/duck/Phitsanulok/NIAH6-2-0044/2004 HA (4) 1188 2004 H5N1
DQ083581 A/duck/Saraburi/Thailand/CU-74/04 HA (4) 1700 2004 H5N1
AY854190 A/duck/Shandong/093/2004 HA (4) 1779 2004 H5N1
AY779048 A/duck/Thailand/CU-2/2004 HA (4) 1653 2004 H5N1
AY553797 A/duck/Thailand/Kamphaengphet-01/2004 HA (4) 1093 2004 H5N1
AY553786 A/duck/Thailand/Phichit-01/2004 HA (4) 1088 2004 H5N1
AY553792 A/duck/Thailand/Sukhothai-01/2004 HA (4) 1107 2004 H5N1
DQ017288 A/duck/Uthaithani-2-01/2004 HA (4) 1094 2004 H5N1
DQ017303 A/duck/Uthaithani-2-02/2004 HA (4) 1094 2004 H5N1
DQ099756 A/duck/Viet Nam/TG-007A/2004 HA (4) 1707 2004 H5N1
DQ497702 A/duck/Vietnam/148/2004 HA (4) 1695 2004 H5N1
DQ497684 A/duck/Vietnam/219/2004 HA (4) 1692 2004 H5N1
DQ497685 A/duck/Vietnam/220/2004 HA (4) 1692 2004 H5N1
DQ497716 A/duck/Vietnam/258/2004 HA (4) 1692 2004 H5N1
DQ497673 A/duck/Vietnam/40/2004 HA (4) 1695 2004 H5N1
DQ497683 A/duck/Vietnam/48/2004 HA (4) 1695 2004 H5N1
DQ497686 A/duck/Vietnam/N-XX/2004 HA (4) 1692 2004 H5N1
DQ191688 A/golden mountain thrush/Fujian/376/04 HA (4) 841 2004 H5N1
EF473070 A/goose/Cambodia/28/2004 HA (4) 1662 2004 H5N1
ISDN49121 A/goose/Cambodia/28/2004 HA (4) 1662 2004 H5N1
AY639405 A/goose/China/F3/2004 HA (4) 1707 2004 H5N1
DQ836043 A/goose/Huadong/220/2004 HA (4) 1779 2004 H5N1
DQ497707 A/goose/Vietnam/264/2004 HA (4) 1692 2004 H5N1
AY651332 A/Gs/Thailand/79/2004 HA (4) 1697 2004 H5N1
AJ715872 A/Hanoi/03/2004 HA (4) 1312 2004 H5N1
AJ867074 A/Hatay/2004 HA (4) 1707 2004 H5N1
AY590569 A/kalij pheasant/Thailand/CU-4/2004 HA (4) 1626 2004 H5N1
DQ083566 A/Kalji Pheasant/Bangkok/Thailand/CU-18/04 HA (4) 1660 2004 H5N1
AY646175 A/leopard/Suphanburi/Thailand/Leo-1/04 HA (4) 1712 2004 H5N1
DQ017280 A/little cuckoo-dove/Tak-2-01/2004 HA (4) 1093 2004 H5N1
AY553802 A/little grebe/Thailand/Phichit-01/2004 HA (4) 1079 2004 H5N1
DQ320940 A/Mallard duck/Vietnam/133/2004 HA (4) 1698 2004 H5N1
DQ997218 A/mallard/Guangxi/wt/2004 HA (4) 1779 2004 H5N1
AY553803 A/muscovy duck/Thailand/Tak-01/2004 HA (4) 1077 2004 H5N1
AY576930 A/muscovy duck/Vietnam/MdGL/2004 HA (4) 1521 2004 H5N1
DQ083585 A/Mynas/Ranong/Thailand/CU-209/04 HA (4) 1712 2004 H5N1
AY590577 A/openbill/Thailand/CU-2/2004 HA (4) 1613 2004 H5N1
DQ083567 A/Ostrich/Samut Prakan/Thailand/CU-19/04 HA (4) 1669 2004 H5N1
DQ083574 A/ostrich/Samut Prakan/Thailand/CU-31/04 HA (4) 1680 2004 H5N1
AY553791 A/partridge/Thailand/Sukhothai-01/2004 HA (4) 1094 2004 H5N1
AY553787 A/partridge/Thailand/Uttaradit-01/2004 HA (4) 1080 2004 H5N1
DQ083583 A/pigeon/Samut Prakan/Thailand/CU-202/04 HA (4) 1712 2004 H5N1
DQ236085 A/pigeon/Thailand/KU-03/04 HA (4) 1710 2004 H5N1
EF541392 A/Prachinburi/6231/2004 HA (4) 1741 2004 H5N1
ISDN110940 A/Prachinburi/6231/2004 HA (4) 1741 2004 H5N1
AY651329 A/Qa/Thailand/57/2004 HA (4) 1697 2004 H5N1
DQ320935 A/quail/Malaysia/6309/2004 HA (4) 1659 2004 H5N1
AY590573 A/quail/Thailand/CU-KTH/2004 HA (4) 481 2004 H5N1
DQ099757 A/quail/Viet Nam/TG-007B/2004 HA (4) 1707 2004 H5N1
DQ497715 A/quail/Vietnam/177/2004 HA (4) 1695 2004 H5N1
AY818137 A/quail/Vietnam/36/04 HA (4) 1707 2004 H5N1
DQ083571 A/rollers/Bangkok/Thailand/CU-26/04 HA (4) 1652 2004 H5N1
DQ188908 A/slaty-backed gull/Shandong/59/04 HA (4) 1071 2004 H5N1
DQ083584 A/sparrow/Phang-Nga/Thailand/CU-203/04 HA (4) 1714 2004 H5N1
AY950236 A/swan/Guangxi/307/2004 HA (4) 1779 2004 H5N1
DQ997392 A/swine/Anhui/ca/2004 HA (4) 1779 2004 H5N1
DQ997076 A/swine/Anhui/cb/2004 HA (4) 1683 2004 H5N1
DQ997262 A/swine/Guangxi/wz/2004 HA (4) 1779 2004 H5N1
DQ997253 A/swine/Henan/wy/2004 HA (4) 1779 2004 H5N1
DQ280243 A/swine/Ontario/23866/04 HA (4) 1701 2004 H1N1
AY555150 A/Thailand/1-KAN-1/2004 HA (4) 1739 2004 H5N1
EF541408 A/Thailand/16/2004 HA (4) 1741 2004 H5N1
ISDN40341 A/Thailand/16/2004 HA (4) 1741 2004 H5N1
AY555153 A/Thailand/2-SP-33/2004 HA (4) 1740 2004 H5N1
ISDN49460 A/Thailand/Chaiyaphum/622/2004 HA (4) 1741 2004 H5N1
EF541417 A/Thailand/Chaiyaphum/622/2004 HA (4) 1741 2004 H5N1
EF541411 A/Thailand/Kan353/2004 HA (4) 1741 2004 H5N1
ISDN40918 A/Thailand/Kan353/2004 HA (4) 1741 2004 H5N1
AY679514 A/Thailand/LFPN-2004/2004 HA (4) 1704 2004 H5N1
ISDN40917 A/Thailand/SP83/2004 HA (4) 1741 2004 H5N1
EF541410 A/Thailand/SP83/2004 HA (4) 1741 2004 H5N1
AY646167 A/tiger/Suphanburi/Thailand/Ti-1/04 HA (4) 1712 2004 H5N1
AY842935 A/tiger/Thailand/CU-T3/2004 HA (4) 1648 2004 H5N1
AY972539 A/tiger/Thailand/CU-T4/04 HA (4) 1718 2004 H5N1
AY972540 A/tiger/Thailand/CU-T5/04 HA (4) 1648 2004 H5N1
AY972541 A/tiger/Thailand/CU-T6/04 HA (4) 1726 2004 H5N1
AY866475 A/tiger/Thailand/CU-T7/2004 HA (4) 1762 2004 H5N1
AY972542 A/tiger/Thailand/CU-T8/04 HA (4) 1648 2004 H5N1
AY741215 A/tree sparrow/Henan/1/2004 HA (4) 1707 2004 H5N1
AY741217 A/tree sparrow/Henan/2/2004 HA (4) 1707 2004 H5N1
AY741219 A/tree sparrow/Henan/3/2004 HA (4) 1707 2004 H5N1
AY741221 A/tree sparrow/Henan/4/2004 HA (4) 1707 2004 H5N1
ISDN38686 A/Viet Nam/1194/2004 HA (4) 1741 2004 H5N1
EF541402 A/Viet Nam/1194/2004 HA (4) 1741 2004 H5N1
AY651333 A/Viet Nam/1194/2004 HA (4) 1696 2004 H5N1
AY651334 A/Viet Nam/1203/2004 HA (4) 1697 2004 H5N1
ISDN38687 A/Viet Nam/1203/2004 HA (4) 1741 2004 H5N1
AY818135 A/Viet Nam/1203/2004 HA (4) 1707 2004 H5N1
EF541403 A/Viet Nam/1203/2004 HA (4) 1741 2004 H5N1
ISDN38688 A/Viet Nam/1204/2004 HA (4) 1741 2004 H5N1
EF541404 A/Viet Nam/1204/2004 HA (4) 1741 2004 H5N1
AY651335 A/Viet Nam/3046/2004 HA (4) 1697 2004 H5N1
AY651336 A/Viet Nam/3062/2004 HA (4) 1684 2004 H5N1
ISDN40278 A/Viet Nam/3212/2004 HA (4) 1569 2004 H5N1
EF451059 A/Viet Nam/3212/2004 HA (4) 1589 2004 H5N1
AY720950 A/Viet Nam/DN-33/2004 HA (4) 1075 2004 H5N1
EF456795 A/Viet Nam/JP178/2004 HA (4) 1707 2004 H5N1
ISDN69608 A/Viet Nam/JP178/2004 HA (4) 1707 2004 H5N1
ISDN238650 A/Vietnam/3028/2004 HA (4) 1705 2004 H5N1
DQ497719 A/Vietnam/CL01/2004 HA (4) 1696 2004 H5N1
DQ497720 A/Vietnam/CL02/2004 HA (4) 1626 2004 H5N1
DQ497721 A/Vietnam/CL17/2004 HA (4) 1530 2004 H5N1
DQ497722 A/Vietnam/CL20/2004 HA (4) 1695 2004 H5N1
DQ497723 A/Vietnam/CL26/2004 HA (4) 1696 2004 H5N1
DQ497724 A/Vietnam/CL36/2004 HA (4) 1697 2004 H5N1
DQ083564 A/white peafowl/Bangkok/Thailand/CU-16/04 HA (4) 1712 2004 H5N1
DQ083573 A/white peafowl/Bangkok/Thailand/CU-29/04 HA (4) 1719 2004 H5N1
AY590570 A/white peafowl/Thailand/CU-11/2004 HA (4) 1265 2004 H5N1
AY950235 A/wild duck/Guangdong/314/2004 HA (4) 1779 2004 H5N1
EF587277 A/Beijing/01/2003 HA (4) 1779 2003 H5N1
AY651373 A/black headed gull/Hong Kong/12.1/2003 HA (4) 1696 2003 H5N1
DQ997147 A/chicken/Hubei/wn/2003 HA (4) 1778 2003 H5N1
DQ997156 A/chicken/Hubei/wo/2003 HA (4) 1778 2003 H5N1
DQ997268 A/chicken/Jilin/ha/2003 HA (4) 1779 2003 H5N1
DQ997318 A/chicken/Jilin/hj/2003 HA (4) 1777 2003 H5N1
DQ997352 A/chicken/Jilin/hn/2003 HA (4) 1538 2003 H5N1
DQ997355 A/chicken/Jilin/ho/2003 HA (4) 1779 2003 H5N1
DQ997361 A/chicken/Jilin/hp/2003 HA (4) 1677 2003 H5N1
DQ997370 A/chicken/Jilin/hq/2003 HA (4) 1590 2003 H5N1
DQ997547 A/chicken/Jilin/xw/2003 HA (4) 1779 2003 H5N1
DQ211925 A/chicken/luohuo/3/03 HA (4) 1707 2003 H5N1
DQ497678 A/chicken/Vietnam/19/2003 HA (4) 1695 2003 H5N1
DQ497679 A/chicken/Vietnam/20/2003 HA (4) 1695 2003 H5N1
DQ320938 A/chicken/Vietnam/27/2003 HA (4) 1698 2003 H5N1
DQ497681 A/chicken/Vietnam/28/2003 HA (4) 1695 2003 H5N1
DQ497682 A/chicken/Vietnam/30/2003 HA (4) 1695 2003 H5N1
DQ497691 A/chicken/Vietnam/4/2003 HA (4) 1695 2003 H5N1
DQ497692 A/chicken/Vietnam/5/2003 HA (4) 1695 2003 H5N1
DQ497693 A/chicken/Vietnam/8/2003 HA (4) 1695 2003 H5N1
AY651353 A/Ck/Hong Kong/2133.1/2003 HA (4) 1693 2003 H5N1
AY651357 A/Ck/Hong Kong/FY157/2003 HA (4) 1676 2003 H5N1
AY651355 A/Ck/Hong Kong/WF157/2003 HA (4) 1692 2003 H5N1
AY651367 A/Dk/ST/4003/2003 HA (4) 1697 2003 H5N1
DQ320914 A/duck/Shantou/4610/2003 HA (4) 1689 2003 H5N1
DQ497670 A/duck/Vietnam/15/2003 HA (4) 1695 2003 H5N1
DQ497672 A/duck/Vietnam/17/2003 HA (4) 1695 2003 H5N1
AY676034 A/egret/Hong Kong/757.2/03 HA (4) 1707 2003 H5N1
DQ997405 A/goose/Fujian/bb/2003 HA (4) 1779 2003 H5N1
AY575869 A/Hong Kong/212/03 HA (4) 1664 2003 H5N1
AB212054 A/Hong Kong/213/03 HA (4) 1779 2003 H5N1
AY575870 A/Hong Kong/213/2003 HA (4) 1593 2003 H5N1
ISDN38262 A/Hong Kong/213/2003 HA (4) 1750 2003 H5N1
EF541401 A/Hong Kong/213/2003 HA (4) 1750 2003 H5N1
DQ497671 A/mallard/Vietnam/16/2003 HA (4) 1695 2003 H5N1
DQ497680 A/mallard/Vietnam/21/2003 HA (4) 1695 2003 H5N1
DQ497690 A/mallard/Vietnam/3/2003 HA (4) 1695 2003 H5N1
AY747609 A/swine/Fujian/1/2003 HA (4) 1766 2003 H5N1
AY646424 A/swine/Shandong/2/03 HA (4) 1779 2003 H5N1
DQ023145 A/chicken/China/1/02 HA (4) 1736 2002 H5N1
DQ343152 A/chicken/Hebei/108/02 HA (4) 1707 2002 H5N1
AY575875 A/chicken/Hong Kong/31.4/02 HA (4) 1710 2002 H5N1
DQ320926 A/chicken/Hong Kong/3123.1/2002 HA (4) 1698 2002 H5N1
AY575879 A/chicken/Hong Kong/409.1/02 HA (4) 1692 2002 H5N1
AY575876 A/chicken/Hong Kong/61.9/02 HA (4) 1707 2002 H5N1
AY575878 A/chicken/Hong Kong/96.1/02 HA (4) 1712 2002 H5N1
AY575877 A/chicken/Hong Kong/YU777/02 HA (4) 1659 2002 H5N1
DQ320927 A/chicken/Hong Kongi/86.3/2002 HA (4) 1698 2002 H5N1
DQ997087 A/chicken/Hubei/wf/2002 HA (4) 1630 2002 H5N1
DQ997182 A/chicken/Jiangsu/cz1/2002 HA (4) 1779 2002 H5N1
DQ997283 A/chicken/Jilin/hd/2002 HA (4) 1779 2002 H5N1
DQ997291 A/chicken/Jilin/he/2002 HA (4) 1775 2002 H5N1
DQ997377 A/chicken/Jilin/hf/2002 HA (4) 1779 2002 H5N1
DQ997299 A/chicken/Jilin/hg/2002 HA (4) 1779 2002 H5N1
DQ997308 A/chicken/Jilin/hh/2002 HA (4) 1779 2002 H5N1
DQ997538 A/chicken/Jilin/xv/2002 HA (4) 1779 2002 H5N1
DQ211924 A/chicken/zhoukou/2/02 HA (4) 1707 2002 H5N1
AY651346 A/Ck/Hong Kong/31.2/2002 HA (4) 1701 2002 H5N1
AY651351 A/Ck/Hong Kong/3169.1/2002 HA (4) 1676 2002 H5N1
AY651350 A/Ck/Hong Kong/3176.3/2002 HA (4) 1677 2002 H5N1
AY651347 A/Ck/Hong Kong/37.4/2002 HA (4) 1701 2002 H5N1
AY651349 A/Ck/Hong Kong/YU22/2002 HA (4) 1679 2002 H5N1
AY585357 A/duck/Fujian/01/2002 HA (4) 1707 2002 H5N1
AY585358 A/duck/Fujian/13/2002 HA (4) 1707 2002 H5N1
AY585362 A/duck/Guangdong/22/2002 HA (4) 1708 2002 H5N1
AY585366 A/duck/Guangxi/53/2002 HA (4) 1708 2002 H5N1
AY676033 A/duck/Hong Kong/821/02 HA (4) 1707 2002 H5N1
AY575874 A/duck/Hong Kong/821/02 HA (4) 1686 2002 H5N1
DQ997094 A/duck/Hubei/wg/2002 HA (4) 1779 2002 H5N1
AY585368 A/duck/Shanghai/35/2002 HA (4) 1707 2002 H5N1
AY585369 A/duck/Shanghai/37/2002 HA (4) 1708 2002 H5N1
DQ997531 A/duck/Shanghai/xj/2002 HA (4) 1779 2002 H5N1
ISDN38689 A/Duck/Viet Nam/Ncvd1/2002 HA (4) 1741 2002 H5N1
EF541405 A/duck/Viet Nam/Ncvd1/2002 HA (4) 1741 2002 H5N1
DQ997410 A/duck/Zhejiang/bj/2002 HA (4) 1779 2002 H5N1
AY575872 A/Eg/Hong Kong/757.3/02 HA (4) 1695 2002 H5N1
AY651360 A/feral pigeon/Hong Kong/862.7/2002 HA (4) 1658 2002 H5N1
AY575873 A/G.H/Hong Kong/793.1/02 HA (4) 1465 2002 H5N1
AY651345 A/Gf/Hong Kong/38/2002 HA (4) 1667 2002 H5N1
AY575871 A/goose/Hong Kong/739.2/02 HA (4) 1689 2002 H5N1
AY651359 A/grey heron/Hong Kong/861.1/2002 HA (4) 1696 2002 H5N1
AY575880 A/pheasant/Hong Kong/675.14/02 HA (4) 1653 2002 H5N1
AY651348 A/SCk/Hong Kong/YU100/2002 HA (4) 1701 2002 H5N1
AY651352 A/teal/China/2978.1/2002 HA (4) 1636 2002 H5N1
AY651361 A/tree sparrow/Hong Kong/864/2002 HA (4) 1447 2002 H5N1
DQ343151 A/chicken/Hebei/718/2001 HA (4) 1707 2001 H5N1
AY075027 A/Chicken/Hong Kong/317.5/2001 HA (4) 1748 2001 H5N1
AF509025 A/Chicken/Hong Kong/715.5/01 HA (4) 1668 2001 H5N1
AF509026 A/Chicken/Hong Kong/822.1/01 HA (4) 1375 2001 H5N1
AF509027 A/Chicken/Hong Kong/829.2/01 HA (4) 1368 2001 H5N1
AF509028 A/Chicken/Hong Kong/830.2/01 HA (4) 1529 2001 H5N1
AF509029 A/Chicken/Hong Kong/858.3/01 HA (4) 1554 2001 H5N1
AF509030 A/Chicken/Hong Kong/867.1/01 HA (4) 1406 2001 H5N1
AF509032 A/Chicken/Hong Kong/873.3/01 HA (4) 1537 2001 H5N1
AF509033 A/Chicken/Hong Kong/876.1/01 HA (4) 1537 2001 H5N1
AF509031 A/Chicken/Hong Kong/879.1/01 HA (4) 1668 2001 H5N1
AF509034 A/Chicken/Hong Kong/891.1/01 HA (4) 1659 2001 H5N1
AF509035 A/Chicken/Hong Kong/893.2/01 HA (4) 1497 2001 H5N1
AF509019 A/Chicken/Hong Kong/FY150/01 HA (4) 1644 2001 H5N1
AY221524 A/Chicken/Hong Kong/FY150/01 HA (4) 1705 2001 H5N1
AY221523 A/Chicken/Hong Kong/FY150/01-MB HA (4) 1705 2001 H5N1
AF509016 A/Chicken/Hong Kong/FY77/01 HA (4) 1650 2001 H5N1
AY221522 A/Chicken/Hong Kong/NT873.3/01 HA (4) 1705 2001 H5N1
AY221521 A/Chicken/Hong Kong/NT873.3/01-MB HA (4) 1705 2001 H5N1
AF509024 A/Chicken/Hong Kong/SF219/01 HA (4) 1654 2001 H5N1
AY221529 A/Chicken/Hong Kong/YU562/01 HA (4) 1705 2001 H5N1
AF509017 A/Chicken/Hong Kong/YU562/01 HA (4) 1656 2001 H5N1
AF509018 A/Chicken/Hong Kong/YU563/01 HA (4) 1656 2001 H5N1
AY221528 A/Chicken/Hong Kong/YU822.2/01 HA (4) 1705 2001 H5N1
AY221527 A/Chicken/Hong Kong/YU822.2/01-MB HA (4) 1705 2001 H5N1
DQ003215 A/chicken/Jiande/1218/2001 HA (4) 1677 2001 H5N1
AF468837 A/Duck/Anyang/AVL-1/2001 HA (4) 1748 2001 H5N1
AY585372 A/duck/Fujian/17/2001 HA (4) 1708 2001 H5N1
AY585360 A/duck/Guangdong/01/2001 HA (4) 1708 2001 H5N1
AY585364 A/duck/Guangxi/22/2001 HA (4) 1708 2001 H5N1
AY585365 A/duck/Guangxi/35/2001 HA (4) 1708 2001 H5N1
AY585375 A/duck/Guangxi/50/2001 HA (4) 1708 2001 H5N1
DQ997513 A/duck/Guangxi/xa/2001 HA (4) 1779 2001 H5N1
AY075033 A/Duck/Hong Kong/380.5/2001 HA (4) 1748 2001 H5N1
AF509039 A/Duck/Hong Kong/646.3/01 HA (4) 1440 2001 H5N1
AY585370 A/duck/Shanghai/08/2001 HA (4) 1708 2001 H5N1
AY585367 A/duck/Shanghai/13/2001 HA (4) 1708 2001 H5N1
AY585376 A/duck/Shanghai/38/2001 HA (4) 1708 2001 H5N1
DQ997522 A/goose/Guangdong/xb/2001 HA (4) 1779 2001 H5N1
AF509036 A/Goose/Hong Kong/76.1/01 HA (4) 1674 2001 H5N1
AF509037 A/Goose/Hong Kong/ww100/01 HA (4) 1650 2001 H5N1
ISDN38260 A/Goose/Viet Nam/113/2001 HA (4) 1637 2001 H5N1
EF541399 A/goose/Viet Nam/113/2001 HA (4) 1637 2001 H5N1
EF541400 A/goose/Viet Nam/324/2001 HA (4) 1637 2001 H5N1
ISDN38261 A/Goose/Viet Nam/324/2001 HA (4) 1637 2001 H5N1
AF509020 A/Pheasant/Hong Kong/FY155/01 HA (4) 1674 2001 H5N1
AY221526 A/Pheasant/Hong Kong/FY155/01 HA (4) 1705 2001 H5N1
AY221525 A/Pheasant/Hong Kong/FY155/01-MB HA (4) 1705 2001 H5N1
AF509023 A/Pigeon/Hong Kong/SF215/01 HA (4) 1674 2001 H5N1
AF509022 A/Quail/Hong Kong/SF203/01 HA (4) 1635 2001 H5N1
AF509021 A/Silky Chicken/Hong Kong/SF189/01 HA (4) 1674 2001 H5N1
AY747617 A/swine/Fujian/F1/2001 HA (4) 1779 2001 H5N1
AY585359 A/duck/Fujian/19/2000 HA (4) 1707 2000 H5N1
AY585373 A/duck/Guangdong/07/2000 HA (4) 1708 2000 H5N1
AY585361 A/duck/Guangdong/12/2000 HA (4) 1708 2000 H5N1
AY585374 A/duck/Guangdong/40/2000 HA (4) 1708 2000 H5N1
AY059481 A/Duck/Hong Kong/2986.1/2000 HA (4) 1704 2000 H5N1
AY059476 A/Duck/Hong Kong/ww381/2000 HA (4) 1704 2000 H5N1
AY059477 A/Duck/Hong Kong/ww382/2000 HA (4) 1704 2000 H5N1
AY059478 A/Duck/Hong Kong/ww461/2000 HA (4) 1704 2000 H5N1
AY059479 A/Duck/Hong Kong/ww487/2000 HA (4) 1704 2000 H5N1
AF501235 A/duck/Shanghai/1/2000 HA (4) 1729 2000 H5
AF501234 A/duck/Shanghai/1/2000 HA (4) 1729 2000 H5
AY585371 A/duck/Zhejiang/15/2000 HA (4) 1708 2000 H5N1
AY585377 A/duck/Zhejiang/52/2000 HA (4) 1708 2000 H5N1
AY075030 A/Goose/Hong Kong/3014.5/2000 HA (4) 1748 2000 H5N1
AY059482 A/Goose/Hong Kong/3014.8/2000 HA (4) 1704 2000 H5N1
AF398417 A/Goose/Hong Kong/385.3/2000 HA (4) 1704 2000 H5N1
AF398418 A/Goose/Hong Kong/385.5/2000 HA (4) 1704 2000 H5N1
AY059474 A/Goose/Hong Kong/ww26/2000 HA (4) 1704 2000 H5N1
AY059475 A/Goose/Hong Kong/ww28/2000 HA (4) 1704 2000 H5N1
AY059480 A/Goose/Hong Kong/ww491/2000 HA (4) 1704 2000 H5N1
DQ201829 A/Goose/Huadong/1/2000 HA (4) 1779 2000 H5N1
AY585363 A/duck/Guangxi/07/1999 HA (4) 1708 1999 H5N1
AF216737 A/Environment/Hong Kong/437-10/99 HA (4) 1741 1999 H5N1
AF216713 A/Environment/Hong Kong/437-4/99 HA (4) 1741 1999 H5N1
AF216721 A/Environment/Hong Kong/437-6/99 HA (4) 1741 1999 H5N1
CY014880 A/chicken/New York/14677-13/1998 HA (4) 1745 1998 H6N2
DQ021663 A/chicken/NY/14677-13/98 HA (4) 1050 1998 H6N2
DQ997102 A/chicken/Hubei/wh/1997 HA (4) 1779 1997 H5N1
DQ997111 A/chicken/Hubei/wi/1997 HA (4) 1640 1997 H5N1
DQ997122 A/chicken/Hubei/wj/1997 HA (4) 1779 1997 H5N1
DQ997123 A/chicken/Hubei/wk/1997 HA (4) 1159 1997 H5N1
DQ997133 A/chicken/Hubei/wl/1997 HA (4) 1779 1997 H5N1
DQ997140 A/chicken/Hubei/wm/1997 HA (4) 1591 1997 H5N1
AF364334 A/Goose/Guangdong/3/97 HA (4) 1762 1997 H5N1
AF144305 A/Goose/Guangdong/1/96 HA (4) 1760 1996 H5N1
AF148678 A/goose/Guangdong/1/96 HA (4) 1707 1996 H5N1
L33758 A/Umea/2/91 HA (4) 1032 1991 H1N1
CY004226 A/mallard duck/Alberta/155/1990 HA (4) 1745 1990 H6N3
CY004234 A/mallard duck/Alberta/191/1990 HA (4) 1745 1990 H6N3
CY004242 A/mallard duck/Alberta/253/1990 HA (4) 1745 1990 H6N3
CY021677 A/Canada goose/Ohio/127/1989 HA (4) 1712 1989 H6N8
CY016172 A/green wing teal/Ohio/59/1989 HA (4) 1711 1989 H6N8
DQ021677 A/mallard/OH/115/89 HA (4) 1050 1989 H6N8
DQ021676 A/mallard/OH/73/89 HA (4) 1050 1989 H6
CY020973 A/mallard/Ohio/115/1989 HA (4) 1712 1989 H6N8
CY021205 A/mallard/Ohio/123/1989 HA (4) 1712 1989 H6N8
CY020845 A/pintail/Ohio/73/1989 HA (4) 1711 1989 H6N2
DQ021675 A/mallard/OH/386/88 HA (4) 1050 1988 H6N2
CY012832 A/pintail/Ohio/294/1988 HA (4) 1711 1988 H6N2
CY004515 A/coot/Alberta/134/1987 HA (4) 1745 1987 H6N2
CY004523 A/mallard duck/Alberta/294/1987 HA (4) 1745 1987 H6N2
DQ021658 A/mottled duck/LA/32M/87 HA (4) 1050 1987 H6N2
CY018893 A/black duck/Ohio/101/1986 HA (4) 1707 1986 H6N2
CY016164 A/green wing teal/Ohio/86/1986 HA (4) 1711 1986 H6N2
CY021607 A/mallard/Ohio/81/1986 HA (4) 1710 1986 H6
CY020989 A/mallard/Ohio/81/1986 HA (4) 1711 1986 H6N2
CY021573 A/mallard/Ohio/81/1986 HA (4) 1710 1986 H6N2
CY004194 A/blue-winged teal/Alberta/69/1985 HA (4) 1745 1985 H6N2
CY004186 A/mallard duck/Alberta/10/1985 HA (4) 1745 1985 H6N2
AF100181 A/Mallard Duck/Alberta/211/85 HA (4) 1653 1985 H6N2
CY004202 A/mallard duck/Alberta/76/1985 HA (4) 1745 1985 H6N3
CY005106 A/mallard duck/Alberta/98/1985 HA (4) 1745 1985 H6N2
AY633308 A/mallard/Alberta/98/85 HA (4) 1743 1985 H6N2
CY004210 A/pintail duck/Alberta/111/1985 HA (4) 1745 1985 H6N2
AY633316 A/pintail/Alberta/113/85 HA (4) 1725 1985 H6N2
CY004218 A/shoveler/Alberta/114/1985 HA (4) 1745 1985 H6N2
CY004162 A/blue-winged teal/Alberta/266/1982 HA (4) 1745 1982 H6N6
CY004178 A/blue-winged teal/Alberta/685/1982 HA (4) 1745 1982 H6N4
CY004170 A/mallard duck/Alberta/289/1982 HA (4) 1745 1982 H6N6
CY014953 A/mallard duck/New York/90/1982 HA (4) 1745 1982 H6N8
CY004146 A/pintail duck/Alberta/189/1982 HA (4) 1745 1982 H6N6
CY004154 A/widgeon/Alberta/256/1982 HA (4) 1745 1982 H6N6
CY014945 A/wood duck/New York/60/1982 HA (4) 1745 1982 H6N8
AF091306 A/Swine/Hokkaido/2/81 HA (4) 1778 1981 H1N1
CY005881 A/blue-winged teal/MN/993/1980 HA (4) 1745 1980 H6N6
X57494 A/Swine/Ehime/1/80 HA (4) 1701 1980 H1N1
CY014764 A/turkey/Minnesota/957/1980 HA (4) 1743 1980 H6N6
CY004080 A/mallard duck/Alberta/1081/1979 HA (4) 1745 1979 H6N5
CY004129 A/mallard duck/Alberta/1151/1979 HA (4) 1745 1979 H6N9
CY004072 A/pintail duck/Alberta/1040/1979 HA (4) 1745 1979 H6N5
CY004076 A/pintail duck/Alberta/1045/1979 HA (4) 1745 1979 H6N5
CY004137 A/pintail duck/Alberta/1298/1979 HA (4) 1745 1979 H6N9
CY004086 A/pintail duck/Alberta/1343/1979 HA (4) 1745 1979 H6N4
CY004114 A/pintail duck/Alberta/628/1979 HA (4) 1745 1979 H6N8
CY015160 A/black-legged kittywake/Alaska/295/1975 HA (4) 1758 1975 H16N3
AB296072 A/turkey/Massachusetts/3740/1965 HA (4) 1714 1965 H6N2
AF091307 A/Swine/Wisconsin/1/61 HA (4) 1778 1961 H1N1
AY184805 A/London/1/1918 HA (4) 563 1918 H1N1
|
June 11th, 2007, 06:46 PM
|
|
Senior User
|
|
Join Date: Oct 2006
Posts: 384
|
|
Re: Four-year-old Egyptian girl has bird flu
is this change one we should be concerned about dr Niman......?
|
June 11th, 2007, 06:49 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
Quote:
Originally Posted by vinny
is this change one we should be concerned about dr Niman......?
|
So far all Qinghai isolates with it are mammals (cat or human).
|
June 11th, 2007, 08:31 PM
|
 |
Administrator, Editor
|
|
Join Date: Feb 2006
Posts: 5,204
|
|
Re: Four-year-old Egyptian girl has bird flu
Hat-tip pugmom for finding this article!
Machine-translated from Arabic:
The injury of a child from Qina by the bird flu disease
June 11, 2007
Cairo - It Monday at night the thirty-six human injury by the bird flu disease made sure of a village Abu Dhiab in Dishna center in Qena Governorate.
And doctor Abdul Rahman Shahin the official spokesman stated the Ministry of Health and Population that the 36 human injury is to a child that she is called Dina Ali Taghyan and her age four years ..Pointing out that the child entered the hospital of Qina fevers on Sunday, and she suffers from a rise in the temperature, a boredom with the respiration and a pneumonia, and that after its confrontation with house birds suspected in their injury by the bird flu disease.
And Shahin added that the transfer of child to Al Bakri's facility hospital in Cairo took place for the follow-up of her health condition ..Pointing out that the child's giving of the necessary treatment took place and that her health condition is stable now, and the neighbours of the work of the epidemic investigation to all families individuals.
The sign is worthy that the injuries total since the emergence of the bird flu disease in February from last year until now reached 36 case from it 15 case was dead and 20 case it was cured totally and the condition is 36 reserved in Al Bakri's facility hospital now.
http://www.masrawy.com/News/2007/Egy...flu_egypt.aspx
__________________
...when you have eliminated the impossible, whatever remains, however improbable, must be the truth. - Sherlock Holmes
|
June 11th, 2007, 08:39 PM
|
|
Administrator, Editor
|
|
Join Date: Feb 2006
Posts: 5,204
|
|
Re: Four-year-old Egyptian girl has bird flu
Quote:
|
Originally Posted by Theresa42
Hat-tip pugmom for finding this article!
Machine-translated from Arabic:
The injury of a child from Qina by the bird flu disease
June 11, 2007
Cairo - It Monday at night the thirty-six human injury by the bird flu disease made sure of a village Abu Dhiab in Dishna center in Qena Governorate....
|
There have been suspected cases in/around Dishna before, btw -- back in February:
http://www.flutrackers.com/forum/sho...1&postcount=15
__________________
...when you have eliminated the impossible, whatever remains, however improbable, must be the truth. - Sherlock Holmes
|
June 11th, 2007, 09:17 PM
|
|
Administrator, Editor
|
|
Join Date: Feb 2006
Posts: 5,204
|
|
Re: Four-year-old Egyptian girl has bird flu
There have apparently been delays in Dina/Donia's diagnosis also ... sounds as though she was in a clinic/hospital a week ago (or for a week?) and was discharged but, because her condition worsened, she was brought back to (another?) doc who suspected bf. Here they also report her age as two (2) -- most other reports have said four (4)....
Machine-translated from Arabic:
Donia Ali Tghyan waits for the health report to defining its injury by the influenza after the failure of Qina fevers
June 12, 2007
Qina - from Osama Al Hawari:
Donia Ali Tghyan is the second condition after the child Mayyada who met its death number memorizer 15 between the bird flu victims because of the lag of [delayed] the diagnosis operation. Donia Ali Tghyan who did not exceed the second year [?] from its age lies now in a non stable condition in Al Bakri's facility hospital, after a doctor that named Shehata Mahmoud suspected its condition inside his special clinic and accelerated its transfer to the hospital of Qina fevers.
And she Leone had entered it a week and left it without the suspicion of its condition or the necessary taking towards her and as a result to the non settlement of its condition and appearance of the injury symptoms on it clearly, have been transferred in a car prepared for Al Bakri's facility hospital.
Mayyada [10F] who took the last breaths, two days ago inside Luxor's international hospital - after the lag [delay] of her condition diagnosis and discovered the condition a chest diseases doctor - was behind him a wrong estimation from the hospital and the non examination [Google trans. - lack of proper screening] by the form necessary for the hesitant on him.
And despite that the veterinary medicine report confirmed the non presence of fears between the birds inside Diab's father village west of child Donia Ali Tghyan's birthplace that reaches from the age two years only, this did not prevent taking the necessary precautionary measures to be ready to any circumstances.
And despite that the report related to the Ministry of Health did not define till now the injury of Donia Ali Tghyan by the bird flu, it is clear that the lag [delay] in the diagnosis process has become a reality must be drawn to preserve life.
http://www.ahram.org.eg/Index.asp?Cu...6.htm&DID=9245
__________________
...when you have eliminated the impossible, whatever remains, however improbable, must be the truth. - Sherlock Holmes
|
June 11th, 2007, 11:48 PM
|
|
Editor, Senior Moderator
|
|
Join Date: Feb 2006
Posts: 4,015
|
|
Re: Four-year-old Egyptian girl has bird flu
Map of the location of the two young girls.
|
June 12th, 2007, 06:58 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
New confirmed human case of avian influenza, Qena, Egypt (Case No. 36)
Reported on 11 June 2007 at 7:30 pm
The Ministry of Health and Population, Egypt, has reported a new confirmed case of human influenza (no. 36) in Qena Governorate on 11 June 2007 in a district different from that of case no. 35. The case is a female child aged 4 years. The symptoms started on 7 June and she was referred to Manshyat Bakry General Hospital on the 10th of the same month where she was put on Tamiflu. The case had a history of contact with dead backyard birds, chickens and ducks, one week before the onset of symptoms. In general, her health condition is good.
This brings up the total number of confirmed human cases of avian influenza in Egypt to 36 with 15 deaths
http://www.emro.who.int/
|
June 12th, 2007, 07:13 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
Avian influenza - situation in Egypt - update 17
12 June 2007
The Egyptian Ministry of Health and Population has confirmed a new human case of avian influenza A(H5N1) virus infection. The case has been confirmed by the Egyptian Central Public Health Laboratory and by the WHO H5 Reference Laboratory, US Naval Medical Research Unit No.3 (NAMRU-3).
The case is a 4 years old female from Qena Governorate. She developed symptoms on 7 June and was admitted to hospital on 10 June. She is receiving treatment and is in a stable condition. Initial investigations into the source of her infection indicate exposure to dead birds.
Of the 36 cases confirmed to date in Egypt, 15 have been fatal.
http://www.who.int/csr/don/2007_06_12/en/index.html
|
June 12th, 2007, 08:35 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
|
June 12th, 2007, 08:55 AM
|
|
Senior User
|
|
Join Date: Oct 2006
Posts: 384
|
|
Re: Four-year-old Egyptian girl has bird flu
with H5N1 showing simalarties to the 1918 pandemic virus,is worrrying.
|
June 13th, 2007, 10:46 AM
|
|
Administrator, Editor
|
|
Join Date: Feb 2006
Posts: 5,204
|
|
Re: Four-year-old Egyptian girl has bird flu
Machine-translated from Arabic:
The transfer of injured 36 by the bird flu to Al Bakri's facility hospital ..And a new suspicion condition in Qina
June 13, 2007
Tarek Amin and Mohamed Hamdi wrote
Doctor Abdul Rahman Shahin, the official spokesman of the Ministry of Health, said that the referral of child Dina Ali Tghyan took place "4 years" that fixed its injury by the bird flu to Al Bakri's facility hospital in Cairo for the follow-up of its health condition.
And Shahin pointed out that the child who stays in Aboudiab village in west of Dshna district in Qena Governorate is the injury condition a number 36 by the disease, and has entered the hospital of Qina fevers last Sunday [June 10], and she suffers from a rise in the temperature, a boredom with the respiration and a pneumonia after its confrontation with birds suspected in its injury by the disease, explaining that its giving the necessary medicine took place, and its health condition stable and the neighbour of the work of the epidemic investigation to all family individuals.
To that the hospital of Qina fevers was detained yesterday Hammouda Mohamed Omar from Aboudiab village in west of Dshna, for the suspicion of its injury by the bird flu disease, and it holds the analyses now to make sure of its injury by the disease from its lack.
From its side, the major general Magdi Ayoub, Qina governor, decided the ban of the birds entrance from and to the governorate with the confiscation of cars that is being seized are laden with the smuggled birds from the neighboring governorates, assuming that a veterinarian is present with each ambush in the governorate.
And Ayoub threatened with deposition of any village president that shows in his village foci injured by the bird flu disease, and demanded from them the residence in the streets and the follow-up of situation in the field, dr.
And the Egyptian doctor Mohamed Diaa confirmed, the Ministry of Health deputy in Qena Governorate, that he until now defining the real reason behind the spread of the bird flu virus in Qena Governorate, specially that all domestic farms under observation and the control, pointing out to that pointing out that the real reason may be the random aviculture in the houses or smuggled birds from other governorates.
http://www.almasry-alyoum.com/articl...rticleID=64490
__________________
...when you have eliminated the impossible, whatever remains, however improbable, must be the truth. - Sherlock Holmes
|
June 14th, 2007, 06:44 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
Quote:
Originally Posted by niman
AVIAN INFLUENZA, HUMAN (98): EGYPT
***********************************
It
is true that Egypt is located on a major bird migration route, but
one must not automatically assume that migratory birds, and not
movement of domestic poultry, are responsible for the introduction of
the virus into the country.
A map of Egypt can be accessed at:
< http://www.lib.utexas.edu/maps/africa/egypt_pol97.jpg>.
- Mod.TY] |
Propaganda by ProMed continues. Qinghai H5N1 was in Nile Delta in HEALTHY teal on December, 2005.
The story is in the sequence, and it appears that no one at ProMed, over 2 years after Qinghai, can read an H5N1 sequences.
Truly embarrassing.
|
June 14th, 2007, 06:48 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
http://www.recombinomics.com/News/11...eal_Egypt.html
H5N1 Wild Bird Sequences in Egypt
Recombinomics Commentary
November 17, 2006
HA sequences from H5 isolated from wild birds in Egypt have been released. Although Egypt reported H5N1 to the OIE in February of this year, the two new sequences indicate H5N1 was isolated in a teal in December, 2005. The HA sequence from that isolate, A/teal/Egypt/14051-NAMRU3/2005, is the Qinghai strain, with the common HA cleavage site, GERRRKKR.
|
June 14th, 2007, 06:49 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
LOCUS EF042624 1596 bp cRNA linear VRL 15-NOV-2006
DEFINITION Influenza A virus (A/teal/Egypt/14051-NAMRU3/2005(H5N1))
hemagglutinin (HA) gene, partial cds.
ACCESSION EF042624
VERSION EF042624.1 GI:117395044
KEYWORDS .
SOURCE Influenza A virus (A/teal/Egypt/14051-NAMRU3/2005(H5N1))
ORGANISM Influenza A virus (A/teal/Egypt/14051-NAMRU3/2005(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1596)
AUTHORS Saad,M.D., Gamal-Eldein,M.A., Ahmed,L.S., Yingst,S.L., Parker,M.A.
and Monteville,M.R.
TITLE Possible Introduction of Avian Influenza H5N1 in Egypt by a
Migratory Bird
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1596)
AUTHORS Saad,M.D., Gamal-Eldein,M.A., Ahmed,L.S., Yingst,S.L., Parker,M.A.
and Monteville,M.R.
TITLE Direct Submission
JOURNAL Submitted (04-OCT-2006) Viral and Zoonotic Diseases Research
Program, U.S. Naval Medical Research Unit No. 3, Extension of
Ramses Street, Nasr City, Cairo 11517, Egypt
FEATURES Location/Qualifiers
source 1..1596
/organism="Influenza A virus
(A/teal/Egypt/14051-NAMRU3/2005(H5N1))"
/mol_type="viral cRNA"
/strain="A/teal/Egypt/14051-NAMRU3/2005"
/serotype="H5N1"
/isolation_source="cloacal swab"
/specific_host=" teal duck"
/db_xref="taxon: 409944"
/segment="4"
/country=" Egypt: Damietta governorate"
/collection_date=" Dec-2005"
gene <1..>1596
/gene="HA"
CDS <1..>1596
/gene="HA"
/codon_start=3
/product="hemagglutinin"
/protein_id=" ABK34513.1"
/db_xref="GI:117395045"
/translation="YHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPL
ILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPANDLCYPGNFNDYEE LKHLLSRI
NHFEKIQIIPKSSWSDHEASSGVSSACPYQGRSSFFRNVVWLIKKDNAYP TIKRSYNN
TNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGTSTLNQRLVPKIATR SKVNGQSG
RMEFFWTILKPNDAINFESNGNFIAPENAYKIVKKGDSTIMKSELEYGNC NTKCQTPI
GAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQ GERRRKKRGLFGAIAGFI
EGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMN TQFEAVGR
EFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNL YDKVRLQL
RDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQYSEEARLKREEISGV KLESIGTY
QILSIYSTVASSLALAIMVAGLS"
ORIGIN
1 gttaccatgc aaacaactcg acagagcagg ttgacacaat aatggaaaag aacgtcactg
61 ttacacacgc ccaagacata ctggaaaaga cacacaacgg gaaactctgc gatctagatg
121 gagtgaagcc tctaatttta agagattgta gtgtagctgg atggctcctc gggaacccaa
181 tgtgtgacga attcctcaat gtgccggaat ggtcttacat agtggagaag atcaatccag
241 ccaatgacct ctgttaccca gggaatttca acgactatga agaactgaaa cacctattga
301 gcagaataaa ccattttgag aaaattcaga tcatccccaa aagttcttgg tcagatcatg
361 aagcctcatc aggggtgagc tcagcatgtc cataccaggg aaggtcctcc ttttttagaa
421 atgtggtatg gcttatcaaa aaggacaatg crtacccaac aataaagaga agttacaata
481 ataccaacca agaagatctt ttggtactgt gggggattca ccatccaaat gatgcggcag
541 agcagacaag gctctatcaa aacccaacta cctatatttc cgttgggaca tcaacactaa
601 accagagatt agtaccaaaa atagctacta gatctaaggt aaacgggcaa agtggaagga
661 tggagttctt ttggacaatt ttaaaaccga atgatgcaat aaactttgag agtaatggaa
721 atttcattgc tccagaaaat gcatacaaaa ttgtcaagaa aggggactca acaattatga
781 aaagtgagtt ggaatatggt aactgcaaca ccaagtgtca aactccaata ggggcgataa
841 actctagtat gccattccac aacatccacc ctctcaccat cggggaatgc cccaaatatg
901 tgaaatcaaa cagattagtc cttgctactg ggctcagaaa cagccctcaa ggagagagaa
961 gaagaaaaaa gagaggacta tttggagcta tagcaggttt tatagaggga ggatggcagg
1021 gaatggtaga tggttggtat gggtaccacc atagcaacga gcaggggagt gggtacgctg
1081 cagacaaaga atccactcaa aaggcaatag atggagtcac caataaggtc aactcgatca
1141 ttgacaaaat gaacactcag tttgaggctg ttggaaggga atttaataac ttagaaagga
1201 gaatagaaaa tttaaacaag aagatggaag acggattcct agatgtctgg acttataatg
1261 ctgaacttct ggttctcatg gaaaatgaga gaactctaga ctttcatgac tcaaatgtca
1321 agaaccttta cgacaaggtc cgactacagc ttagggataa tgcaaaggag cttggtaacg
1381 gttgtttcga gttctatcac agatgtgata atgaatgtat ggaaagtgta agaaacggaa
1441 cgtatgacta cccgcagtat tcagaagaag caagattaaa aagagaggaa ataagtggag
1501 taaaattgga atcaatagga acttaccaaa tactgtcaat ttattcaaca gtggcgagct
1561 ccctagcact ggcaatcatg gtggctggtc tatctt
|
June 14th, 2007, 07:03 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
Note to ProMed:
Qinghai H5N1 was isolated in a healthy teal in the Nile Delta in December, 2005. At that time, EVERY country in western Europe, the Middle East, and Africa denied the presence of H5N1 (it was acknowledge in western Turkey and Romania).
At that time ProMed was still spreading the nonsense that H5N1 had not been found in a healthy wild bird, even though Russia had already published a partial sequence of H5N1 from a HEALTHY crested grebe, which had the common Qinghai HA cleavage site GERRRKKR.
In February, 2006, Egypt, along with MANY countries in western Europe, the Middle East, and Africa, acknowledged H5N1 for the FIRST TIME. ALL were the Qinghai strain.
The early 2006 isolates from Egypt, had additional regional markers showing the H5N1 was Qinghai, and was from Egypt, Israel, Gaza, or Djibouti. Those same markers were present in the 2007 human and bird isolates in Egypt, including the fatal case in Qena.
http://www.recombinomics.com/News/06...a_Cluster.html
The blatant ProMed propaganda, in an infectious disease newsletter, continues to be an embarrassment to the scientific community.
|
June 14th, 2007, 07:07 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: Four-year-old Egyptian girl has bird flu
LOCUS DQ190857 271 bp RNA linear VRL 27-SEP-2005
DEFINITION Influenza A virus (A/grebe/Novosibirsk/29/05(H5N1)) hemagglutinin (HA) gene, partial cds.
ACCESSION DQ190857VERSION DQ190857.1 GI:76097668
KEYWORDS .SOURCE Influenza A virus (A/grebe/Novosibirsk/29/2005(H5N1))
ORGANISM Influenza A virus (A/grebe/Novosibirsk/29/2005(H5N1)) Viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 271) AUTHORS Lvov,D.K., Shchelkanov,M.Y., Deryabin,P.G., Grebennikova,T.V., Prilipov,A.G., Nepoklonov,E.A., Onishchenko,G.G., Vlasov,N.A., Aliper,T.I., Zaberezhny,A.D., Kireev,D.E., Krascheninnikov,O.P., Kiryukhin,S.T., Burtceva,E.I. and Slepuschkin,A.N.
TITLE Isolation of Influenza A/H5N1 virus strains from poultry and wild birds during epizootic outbreak in Western Siberia (July 2005) and their incorporation in Russian State Collection of Viruses (August 08, 2005)
JOURNAL Vopr. Virusol. (2005) In pressREFERENCE 2 (bases 1 to 271)
AUTHORS Lvov,D.K., Shchelkanov,M.Y., Deryabin,P.G., Grebennikova,T.V., Prilipov,A.G., Nepoklonov,E.A., Onishchenko,G.G., Vlasov,N.A., Aliper,T.I., Zaberezhny,A.D., Kireev,D.E., Krascheninnikov,O.P., Kiryukhin,S.T., Burtceva,E.I. and Slepuschkin,A.N.
TITLE Direct Submission JOURNAL Submitted (01-SEP-2005) Virus Evolution and Ecology, D.I. Ivanovski Virology Institute, 16 Gamalei Str., Moscow 123098, Russia
FEATURES Location/Qualifiers source 1..271 /organism="Influenza A virus (A/grebe/Novosibirsk/29/2005(H5N1))"
/mol_type="genomic RNA"
/strain="A/grebe/Novosibirsk/29/05"
/serotype="H5N1"
/isolation_source=" great crested grebe (Podiceps cristatus) without clinical signs of influenza"
/db_xref="taxon: 353252"
/country="Russia" /note="type: A" gene <1..>271
/gene="HA" CDS <1..>271
/gene="HA" /codon_start=3 /product="hemagglutinin" /protein_id=" ABA39516.1"
/db_xref="GI:76097669"
/translation="INSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQ GERRRK KRGLFGAIAGFIEGGWQGMVDGWYGYRHSNEQGSGYAADKESTQKA"
ORIGIN
1 tgataaattc tagcatgcca ttccacaaca tccaccctct caccatcggg gaatgcccca
61 aatatgtgaa atcaaacaga ttagtccttg cgactgggct tagaaatagc cctcaaggag
121 agagaagaag aaaaaagaga ggactatttg gagctatagc aggttttata gagggaggat
181 ggcagggaat ggtagatggt tggtatgggt accgccatag caacgagcag gggagtgggt
241 acgctgcaga caaagaatcc actcaaaagg c//
|
June 14th, 2007, 12:03 PM
|
|
Administrator, Editor
|
|
Join Date: Feb 2006
Posts: 5,204
|
|
Re: Four-year-old Egyptian girl has bird flu
Quote:
|
Originally Posted by post #22
To that the hospital of Qina fevers was detained yesterday Hammouda Mohamed Omar from Aboudiab village in west of Dshna, for the suspicion of its injury by the bird flu disease, and it holds the analyses now to make sure of its injury by the disease from its lack.
|
I hope 11 month old Hammouda Mohamed Omar is not Dina's brother (and that the authorities/press have failed to mention that). Here's a photo of Dina with, I'm guessing, her father and possibly a sibling -- the other child could be around 11 months, couldn't he? (But maybe Dina's not 4 in that picture.) Just speculating....
__________________
...when you have eliminated the impossible, whatever remains, however improbable, must be the truth. - Sherlock Holmes
|
June 15th, 2007, 04:23 AM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: Four-year-old Egyptian girl has bird flu
Quote:
Originally Posted by niman
|
Commentary
H5N1 Cluster in Qena Egypt Raises Concerns
Recombinomics Commentary
June 12, 2007
Donia Ali Tghyan who did not exceed the second year from its age lies now in a non stable condition in Al Bakri's facility hospital, after a doctor that named Shehata Mahmoud suspected its condition inside his special clinic and accelerated its transfer to the hospital of Qina fevers.
And she Leone had entered it a week and left it without the suspicion of its condition or the necessary taking towards her and as a result to the non settlement of its condition and appearance of the injury symptoms on it clearly, have been transferred in a car prepared for Al Bakri's facility hospital.
The above translation suggests the latest confirmed H5N1 case (4F) in Qena, Egypt developed symptoms at the beginning of this month, like the recent fatal case (10F), although the situation update indicates she developed symptoms on June 7.
The translation, like media reports on the earlier case, indicates an H5N1 diagnosis was not made initially. The failure to diagnose these cases early is not a surprise because H5N1 cases this late in the season are unusual, and earlier cases in southern (upper) Egypt were mild. The confirmation of mild cases raised concerns, because such cases would be easily missed.
NAMRU-3 generated HA and NA sequences from the earlier cases. The HA sequences readily divided the cases into two sub-clades. Although all isolates had Qinghai markers as well as regional markers identified by isolates from Egypt, Israel, Gaza, and Djibouti in early 2006, the recent cases had a large number of sub-regional markers appended onto the genetic background defined by the isolates from early 2006. The grouping of these cases and geographical locations are listed below, including those with the 3 BP deletion. However, the two most recent isolates below had reverted to the wild type Qinghai cleavage site, and the patient that died this month had reverted 8 of the 14 sub-regional markers.
This rapid reversion raises concerns that the evolution of the H5N1 linked to mild cases may become more virulent. The latest fatality is the first child to die of H5N1 in Egypt and the mild nature of the earlier cases, coupled with the clustering in time and space, raises concerns that the number of H5N1 cases may be significantly higher than indicated in the confirmed totals.
Moreover, the two recent HA sequences that had reverted sub-regional markers did have N98D (N103D in H3 numbering), which was present in early H1N1 cases, including those from 1918.
Careful monitoring of this region is indicated.
3 BP deletion
A/Egypt/0636-NAMRU3/2007 Beni Suef
A/Egypt/1394-NAMRU3/2007 Fayoum
A/Egypt/2621-NAMRU3/2007 Qena
A/Egypt/2629-NAMRU3/2007 Qena
A/Egypt/2631-NAMRU3/2007 Qalubiea
Mongolian cleavage site
A/Egypt/2321-NAMRU3/2007 Aswan
A/Egypt/2331-NAMRU3/2007 Aswan
A/Egypt/2616-NAMRU3/2007 Aswan
A/Egypt/2620-NAMRU3/2007 Menia
A/Egypt/2750-NAMRU3/2007 Menia
A/Egypt/4081-NAMRU3/2007 Qena
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|
July 1st, 2007, 06:56 AM
|
|
Administrator, Editor
|
|
Join Date: Feb 2006
Posts: 5,204
|
|
Re: Four-year-old Egyptian girl has bird flu
Bird-flu patients Donia (4F) and Emad (4M) discharged from hospital (yay!).
Emad's father and twin siblings who were also hospitalized with flu-like symptoms test negative (the siblings were reported earlier, I believe -- although I wasn't aware that they were twins; didn't know Emad's father had been in hospital until now.)
Emad's initial symptoms included a high fever and severe headache.
Hat-tip to pugmom for finding this article! (Cross-posted in Emad thread.)
Machine-translated from Arabic:
After he followed up Ahram [the newspaper] every moment their tragedy is with the bird flu
Donia and Emad returned romping in their village again
July 1, 2007
Qina - from Osama Al Hawari:
My village peoples eyes stayed up Abu Diab west of in Dishna and the middle is Qamoula 'by his critics' [Banagadeh] yesterday evening till morning waiting of the arrival of their [two] children, Donia Ali Tghyan and Emad Mohamed Mohamed Al Daramalli after a therapeutic trip that reached the recovery of children from the bird flu, that the one that Ahram their conditions have followed up since the first hours from their disease and before the declaration of the central laboratories their injury.
With rings at three from yesterday's dawn he was Al Shawwan [Naga] hamlet in Abu Diab village west of on a non known date and he is the view of their daughter Donia Ali Nghyan the intervention of their hamlet Ali's [Ngian Njahm] livestock its feet and smiling the recovery accompanies it so that Al Zarid rushes that rejoiced over it after they went out of Al Ngh [Najah] same before 40 days in aid vehicle and in a serious condition extremely.
"The seriousness of a world" [Donia] was first who was keen she on its kissing and all started being entangled from around it joying with its return a safe once again after the worry was about to it is to defame all the one(s) who knows it.
As for the father of "the world" [Donia] of the simple farmer, he has confirmed to Ahram that he will not make forget at all that the country was keen on the life of his daughter more than him nevertheless he did not reduce the neglect size that its daughter was exposed to with the lag of its condition diagnosis despite its entrance to the hospital of Qina fevers.
As for Donia Wlti's mother she rushed inside the family house so that the women hands receive her there for her congratulation on the return of her daughter and they were content with making the trills as an expression of their happiness with it a safe.
Mahmoud Al Sayed said that he when he watched a world [Donia] brings out of its house that believed that it got out of the world but he did not believe his eyes when the child same opinion his house enters its feet and she romps and plays as was before.
And after nearly an hour and half the car that carried a world has stopped by its critics position so that the injured second condition declares Emad Al Daramalli's return the injured second condition and that its rescue of the vitality that the old child appeared on took place made the village peoples grant the continuous trills despite the approach of the dawn ears inside their village by the middle Qamoula [Balaust Kamula].
The child father said to Ahram delegate the recorded samples that have been taken who commemorated him a passivity came and that he is happy extremely with the recovery of his older son Emad and added that the media notifications were the main reason behind its early discovery to its son condition Emad who was mixing with house birds, it injured its considering by a severe headache and hotness condition have been transferred on its trace to the Fever Hospital after what doubted that its son is injured by the bird flu.
And Mohamed Mohamed Al Daramalli [Emad's father] child Emad's father said that he is he also that started suffering from the suspicion symptoms and have been reserved with Emad inside his critics fevers then by the fevers of Qina and the cadastral [smear] samples that have been taken from his son [Emad] have come a positive, while the sample related to him [the father] came a negative as the suspicion of its [his other] children took place the twin is Safaa and on a year and half nevertheless their cadastral [smear] samples came a passivity.
As for Sherifa Farag the judge child Emad's mother she has directed the thanks to the Ministry of Health on her severe care with the care of her son, that has been injured on Thursday before the last and its transfer of Qina adenoids took place on Friday and same evening today have been transferred to Al Bakri's facility hospital so that the team or the medical rescuer carry out the hospital thereafter in his injection with two drugs Lutami or the rescuer for the life then it took initial samples of it and a passivity came then another sample of the blood and the saliva was taken and came a passivity yesterday noon.
And there in the middle child Emad birthplace East Qamoula the happiness prevailed in all the village areas that include 16 hamlets that have lived in a severe fear after their discovery of the injury of their son Emad and before that it was suspected the injury of his father and its brothers the twin.
Child Emad's uncle claims Ahmed Al Saadi he said to Ahram that his brother has hidden the birds inside a wooden cage for fear of her execution by the veterinary medicine team who has the village's blockaded of a search about the birds.
The manager of Qina fevers accompanied the child until his exit
In a good gesture he took precautions to it as a doctor first and a father thereafter agreed Dr. Gamal Abdul Azim his critics fevers hospital manager Ali reserved the child Emad inside Al Bakri's facility hospital for 4 continuous days a rejecting that he leaves them before the reassurance of them and that after he threatened pillar father in his critics hospital with the referral of matter to the highest authorities if the reservation of child did not take place he is what pleased Emad's family with that good gesture from the hospital doctor.
http://www.ahram.org.eg/Index.asp?Cu...3.htm&DID=9264
__________________
...when you have eliminated the impossible, whatever remains, however improbable, must be the truth. - Sherlock Holmes
|
|
|
|
Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
|
|
|
| Thread Tools |
Search this Thread |
|
|
|
| Display Modes |
 Linear Mode
|
Posting Rules
|
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts
HTML code is On
|
|
|
Disclaimer:
The reader is responsible for discerning the validity, factuality or implications of information posted here, be it fictional or based on real events. Moderators on this forum make every effort to review the material posted on this site however, it is not realistically possible for our staff to manually review each post.
The content of posts on this site, including but not limited to links to other web sites, are the expressed opinion of the original authors or posters and are not endorsed by, or representative of the opinions of, the owners or administration of this website. The posts on this website are the opinion of the specific author or poster and should not be construed as statements of advice or factual information.
Not all posts on this website are intended as truthful or factual assertion by their authors. NO posts on this website should be considered factual information on face value alone. Users are encouraged to USE DISCERNMENT and do their own follow up research while reading and posting on this website. FluTrackers.com Inc. reserves the right to make changes to, corrections and/or remove entirely at any time posts made on this website without notice. In addition, FluTrackers.com Inc. disclaims any and all liability for damages incurred directly or indirectly as a result of a post on this website.
This site is provided "as is" without warranty of any kind, either expressed or implied. You should not assume that this site is error-free or that it will be suitable for the particular purpose which you have in mind when using it. In no event shall FluTrackers.com Inc. be liable for any special, incidental, indirect or consequential damages of any kind, or any damages whatsoever, including, without limitation, those resulting from loss of use, data or profits, whether or not advised of the possibility of damage, and on any theory of liability, arising out of or in connection with the use or performance of this site or other documents which are referenced by or linked to this site.
Finally, FluTrackers.com Inc. reserves the right to delete, correct, or make changes to any post on this website without notice at any time for any reason.
Fair Use Notice:
This site may contain copyrighted material the use of which has not always been specifically authorized by the copyright owner. Users may make such material available in an effort to advance awareness and understanding of issues relating to public health, civil rights, economics, individual rights, international affairs, liberty, science & technology, etc. We believe this constitutes a 'fair use' of any such copyrighted material as provided for in section 107 of the US Copyright Law. In accordance with Title 17 U.S.C.Section 107, the material on this site is distributed to those who have expressed a prior interest in receiving the included information for research and educational purposes.
In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article. Please remember you are responsible for what you post on the internet and you could be sued by the original copyright holder if you do not honor these rules.
If you are a legal copyright holder or a designated agent for such and you believe a post on this website falls outside the boundaries of "Fair Use" and legitimately infringes on yours or your clients copyright
we may be contacted concerning copyright matters at:
FluTrackers.com Inc.
c/o Sharon Sanders
1676 Hibiscus Avenue
Winter Park, Florida 32789
Phone: 407-406-3037
E-Mail: flutrackers@earthlink.net
In accordance with section 512 of the U.S. Copyright Act our contact information has been registered with the United States Copyright Office. "Safe Harbor" noticing procedures as outlined in the DMCA apply to this website concerning all 3rd party posts published herein.
If notice is given of an alleged copyright violation we will act expeditiously to remove or disable access to the material(s) in question.
All 3rd party material posted on this website is the copyright of the respective owners / authors. FluTrackers.com Inc. makes no claim of copyright on such material.
For more information please visit:
http://www.law.cornell.edu/uscode/17/107.shtml
Please be aware any communications sent complaining about a post on this website may be posted publicly at the discretion of the administration.
FluTrackers Does Not Provide Any Medical Advice:
FluTrackers, Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster.
The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website.
By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
By using and/or accessing this site, either passively or actively, you are agreeing to all of the above conditions. Also, by using and/or accessing this site, either passively or actively, you agree to conduct all business and legal affairs related to this website in the jurisdiction of Flutrackers.com Inc. which is registered in Central Florida, USA.
These Disclaimers are subject to change at anytime.
Email the Webmaster with questions or comments about this site at flutrackers@earthlink.net
All times are GMT -4. The time now is 05:37 PM.
|
