 |
|
May 23rd, 2008, 01:05 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
H5N1 From Primorie (2008)
LOCUS EU672460 1373 bp cRNA linear VRL 21-MAY-2008
DEFINITION Influenza A virus (A/chicken/Primorje/1/2008(H5N1)) neuraminidase
(NA) gene, complete cds.
ACCESSION EU672460
VERSION EU672460.1 GI:188526736
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
ORGANISM Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1373)
AUTHORS Usacheva,O.V. and Prilipov,A.G.
TITLE Direct Submission
JOURNAL Submitted (23-APR-2008) Molecular Genetic Laboratory, Ivanovsky
Virology Institute, Russian Academy of Medical Science, Gamalei 16,
Moscow 123098, Russia
FEATURES Location/Qualifiers
source 1..1373
/organism="Influenza A virus
(A/chicken/Primorje/1/2008(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Primorje/1/2008"
/serotype="H5N1"
/specific_host="chicken"
/db_xref="taxon: 529073"
/country="Russia: Vozdvizhenka, Ussuriisky region,
Primorsky krai"
/collection_date="10-Apr-2008"
gene 9..1358
/gene="NA"
CDS 9..1358
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id=" ACD62245.1"
/db_xref="GI:188526737"
/translation="MNPNQKIITIGSVCMIIGIVSLMLQIGNMISIWVSHSIQTGNQH
QAEPIRNTNFLTENAVASVTLAGNSSLCPIRGWAVHSKDNSIRIGSKGDV FVIREPFI
SCSHMECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPVGEAPSPYNS RFESVAWS
ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESE CACVNGSC
FTVMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEI ICVCRDNW
HGSNRPWISFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSPNGAYGI KGFSFKYG
NGVWIGRTKSTNSRSGFEMIWDPNGWTGTDSEFSVKQDIVAITDWSGYSG SFVQHPEL
TGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVSWSWPDGAE LPFTIDK"
ORIGIN
1 agttcaaaat gaatccaaat cagaagataa taaccattgg atcagtctgt atgataattg
61 gaatagttag cttaatgtta cagattggga acatgatctc aatatgggtc agtcattcaa
121 ttcaaacagg gaatcaacac caagctgaac caatcagaaa taccaatttt cttactgaga
181 acgctgtggc ttcagtaaca ttagcgggca attcatctct ttgccccatt agaggatggg
241 ctgtacacag taaagacaac agtataagga ttgggtccaa gggggatgtg tttgtaatta
301 gagagccgtt catctcatgc tcccatatgg aatgcagaac tttctttttg actcagggag
361 ccttactgaa tgacaagcac tccaacggga ctgtcaaaga caggagccct cacagaacac
421 taatgagttg tcctgtgggt gaggctccct ccccatataa ctcgaggttt gagtctgttg
481 cttggtcagc aagtgcttgc catgatggca ccagttggtt gacaattgga atttctggtc
541 cagacaatgg ggctgtggct gtattgaaat acaatggcat aataacagac actatcaaga
601 gttggaggaa caacatactg aggactcaag agtctgaatg tgcatgtgta aatggctctt
661 gctttactgt aatgacagat ggaccaagta atggacaggc atcatataag atcttcaaaa
721 tagaaaaagg gaaagtagtt aaatcggtcg aattgaatgc tcctaattat cactatgagg
781 aatgctcctg ttatcctgat gctggcgaaa taatatgtgt gtgcagggac aattggcatg
841 gctcaaatag gccatggata tctttcaatc agaatttgga gtatcaaata ggatatattt
901 gcagtggggt tttcggagac aatccacggc caaatgatgg gacaggtagt tgtggtccaa
961 tgtcccctaa cggggcatat gggataaaag ggttttcatt taaatacggt aatggtgttt
1021 ggatcgggag aaccaaaagc actaattcca gaagcggttt tgaaatgatt tgggatccaa
1081 atgggtggac tggaacggac agtgaatttt cggtgaaaca agatatagta gcaataactg
1141 attggtcagg atatagcggg agttttgtcc agcatccgga actgacagga ttagactgca
1201 taagaccttg cttctgggtt gagttaatca gggggcggcc aaaagagagc acaatttgga
1261 ctagtgggag cagcatatct ttttgtggtg taaatagtga cactgtgagt tggtcttggc
1321 cagacggtgc tgagttgcca ttcaccattg acaagtagtt tattcaaaaa act
|
May 23rd, 2008, 01:09 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
NA is closely related to sequences from Japan
|
May 23rd, 2008, 01:10 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
LOCUS EU672458 1540 bp cRNA linear VRL 21-MAY-2008
DEFINITION Influenza A virus (A/chicken/Primorje/1/2008(H5N1)) nucleocapsid
protein (NP) gene, complete cds.
ACCESSION EU672458
VERSION EU672458.1 GI:188526731
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
ORGANISM Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1540)
AUTHORS Usacheva,O.V. and Prilipov,A.G.
TITLE Direct Submission
JOURNAL Submitted (23-APR-2008) Molecular Genetic Laboratory, Ivanovsky
Virology Institute, Russian Academy of Medical Science, Gamalei 16,
Moscow 123098, Russia
FEATURES Location/Qualifiers
source 1..1540
/organism="Influenza A virus
(A/chicken/Primorje/1/2008(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Primorje/1/2008"
/serotype="H5N1"
/specific_host="chicken"
/db_xref="taxon: 529073"
/country="Russia: Vozdvizhenka, Ussuriisky region,
Primorsky krai"
/collection_date="10-Apr-2008"
gene 34..1530
/gene="NP"
CDS 34..1530
/gene="NP"
/codon_start=1
/product="nucleocapsid protein"
/protein_id=" ACD62242.1"
/db_xref="GI:188526732"
/translation="MASQGTKRSYEQMETGGERQNATEIRASVGRMVSGIGRFYIQMC
TELKLSDYEGRLIQNSITIERMVLSAFDERRNRYLEEHPSAGKDPKKTGG PIYRRRDG
KWVRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTR ALVRTGMD
PRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGE NGRRTRIA
YERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRG SVAHKSCL
PACVYGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKS QLVWMACH
SAAFEDLRVSSFIRGTRVVPRGQLSTRGVQIASNENMEAMDSNTLELRSR YWAIRTRS
GGNTNQQRASAGQISIQPTFSVQRNLPFERATIMAAFTGNTEGRTSDMRT EIIRMMES
ARPEDVSFQGRGVFELSDEKATNPIVPSFDMNNEGSYFFGDNAEEYDN"
ORIGIN
1 gtagataatc actcaccgag tgacatcaac attatggcgt cccaaggcac caaacgatct
61 tatgaacaga tggaaactgg tggagagcgc cagaatgcta ctgagatcag ggcatccgtt
121 ggaagaatgg ttagtggcat tgggagattc tacatacaga tgtgcacaga actcaaactc
181 agtgactatg aaggaagact gatccagaac agcataacaa tagagagaat ggtactttct
241 gcatttgatg aaagaaggaa caggtacctg gaagaacacc ccagtgcggg gaaggacccg
301 aagaaaactg gaggtccaat ttatcggagg agagacggaa aatgggtgag ggagctgatt
361 ctgtacgaca aagaggagat caggaggatt tggcgtcaag cgaacaatgg agaggacgca
421 actgctggtc ttacccacct gatgatatgg cattccaatc taaatgatgc cacatatcag
481 agaacgagag ctctcgtgcg tactggaatg gatcccagga tgtgctctct gatgcaagga
541 tcaaccctcc cgaggagatc tggagctgcc ggtgcagcag tgaagggggt aggaacaatg
601 gtgatggagc tgattcggat gataaaacgg ggaatcaacg accggaattt ttggagaggt
661 gaaaatggaa gaagaacaag gattgcatat gagagaatgt gcaacatcct caaagggaaa
721 ttccaaacag cagcacaaag agcaatgatg gatcaagtgc gagagagcag aaatcctggg
781 aatgctgaaa ttgaagatct catttttctg gcacggtctg cactcatcct gagaggatca
841 gtggcccata agtcctgctt gcctgcctgt gtgtacggac ttgcagtggc cagtggatat
901 gactttgaga gagaagggta ctctctggtt gggatagatc ccttccgtct gcttcaaaac
961 agccaggtct ttagtctcat tagaccaaat gagaatccag cacataagag tcaattagtg
1021 tggatggcat gccactctgc agcatttgag gaccttagag tctcaagttt catcagaggg
1081 acaagagtgg tcccaagggg acagctatcc accagagggg ttcaaattgc ttcaaatgag
1141 aatatggaag caatggactc caacactctt gaactgagaa gtagatattg ggctataaga
1201 accagaagcg gaggaaacac caaccagcag agggcatctg cagggcagat cagcattcag
1261 cccactttct cggtacagag aaaccttccc ttcgaaagag cgaccattat ggcagcattt
1321 acaggaaata ctgagggcag aacgtctgac atgaggactg aaatcataag aatgatggaa
1381 agtgccagac cagaagatgt gtcattccag gggcggggag tcttcgagct ctcggacgaa
1441 aaggcaacga acccgatcgt gccttccttt gacatgaata atgaaggatc ttatttcttc
1501 ggagacaatg cagaggagta tgacaattaa agaaaaatac
|
May 23rd, 2008, 01:10 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
NP is closely related to sequences from Japan
|
May 23rd, 2008, 01:13 PM
|
 |
Editor and Director of the Vietnam Forum
|
|
Join Date: May 2006
Posts: 8,933
|
|
Re: H5N1 From Primorie (2008)
map of Ussuriisky region
http://tinyurl.com/52dlhu
|
May 23rd, 2008, 01:15 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
LOCUS EU672459 850 bp cRNA linear VRL 21-MAY-2008
DEFINITION Influenza A virus (A/chicken/Primorje/1/2008(H5N1)) nonstructural
protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete
cds.
ACCESSION EU672459
VERSION EU672459.1 GI:188526733
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
ORGANISM Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 850)
AUTHORS Usacheva,O.V. and Prilipov,A.G.
TITLE Direct Submission
JOURNAL Submitted (23-APR-2008) Molecular Genetic Laboratory, Ivanovsky
Virology Institute, Russian Academy of Medical Science, Gamalei 16,
Moscow 123098, Russia
FEATURES Location/Qualifiers
source 1..850
/organism="Influenza A virus
(A/chicken/Primorje/1/2008(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Primorje/1/2008"
/serotype="H5N1"
/specific_host="chicken"
/db_xref="taxon: 529073"
/country="Russia: Vozdvizhenka, Ussuriisky region,
Primorsky krai"
/collection_date="10-Apr-2008"
gene 15..837
/gene="NS2"
CDS join(15..44,502..837)
/gene="NS2"
/codon_start=1
/product="nonstructural protein 2"
/protein_id=" ACD62243.1"
/db_xref="GI:188526734"
/translation="MDSNTVSSFQDILVRMSKMQLASSSEDLNGMITQFGSLKLYRDS
LGEAVMRVGDFHSLQIRNGKWREQLSQKFEEIRWLIEEVRHRLKITENSF EQITFMQA
LQLLLEVEQEIRAFSFQLI"
gene 15..692
/gene="NS1"
CDS 15..692
/gene="NS1"
/codon_start=1
/product="nonstructural protein 1"
/protein_id=" ACD62244.1"
/db_xref="GI:188526735"
/translation="MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDKKSLR
GRGNTLGLDIETATRAGKQIVERILEEESDEALKMPTSRYLTDMTLEEMS RDWFMLMP
KQKAAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIV GEISPLPS
LPGHTGEDVKNAIGVLIGGLEWNDNTVRVSETIQRFAWRSSDEGGRLPLP PNQKRKMA
RTIESEV"
ORIGIN
1 gtgacaaaaa cataatggat tccaacactg tgtcaagctt tcaggtagac tgctttcttt
61 ggcatgtccg caaacgattt gcagaccaag aactgggtga tgccccattc cttgaccggc
121 tccgccgaga taagaagtcc ctaagaggaa gaggcaacac tcttggtctg gacatcgaaa
181 cagctactcg tgcgggaaaa cagatagtgg agcggattct ggaggaggaa tccgatgagg
241 cacttaaaat gccgacttca cgctacctaa ctgacatgac tctcgaagaa atgtcaaggg
301 actggttcat gctcatgccc aagcagaaag cggcgggttc cctttgcatc aaaatggacc
361 aggcaataat ggataaaacc atcatattga aagcaaactt cagtgtgatt tttgaccggt
421 tagaaaccct aatactgctt agagctttca cagaagaagg agcaatcgtg ggagaaatct
481 caccattacc ttctcttcca ggacatactg gtgaggatgt caaaaatgca attggcgtcc
541 tcatcggagg acttgaatgg aatgataaca cagttcgggt ctctgaaact atacagagat
601 tcgcttggag aagcagtgat gagggtggga gacttccact ccctccaaat cagaaacgga
661 aaatggcgag aacaattgag tcagaagttt gaagaaataa ggtggctaat tgaagaagta
721 cgacatagat tgaaaattac agaaaacagc ttcgaacaga taacgtttat gcaagcctta
781 caactactgc ttgaagtgga gcaagagata agagccttct cgtttcagct tatttaatga
841 taaaaaacac
|
May 23rd, 2008, 01:15 PM
|
|
Editor and Director of the Vietnam Forum
|
|
Join Date: May 2006
Posts: 8,933
|
|
Re: H5N1 From Primorie (2008)
Dr Niman, I can't seem to find how many chickens were tested/found?
|
May 23rd, 2008, 01:16 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
NS is closely related to sequences from Japan.
|
May 23rd, 2008, 01:22 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
LOCUS EU672457 2208 bp cRNA linear VRL 21-MAY-2008
DEFINITION Influenza A virus (A/chicken/Primorje/1/2008(H5N1)) polymerase PA
(PA) gene, complete cds.
ACCESSION EU672457
VERSION EU672457.1 GI:188526729
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
ORGANISM Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2208)
AUTHORS Usacheva,O.V. and Prilipov,A.G.
TITLE Direct Submission
JOURNAL Submitted (23-APR-2008) Molecular Genetic Laboratory, Ivanovsky
Virology Institute, Russian Academy of Medical Science, Gamalei 16,
Moscow 123098, Russia
FEATURES Location/Qualifiers
source 1..2208
/organism="Influenza A virus
(A/chicken/Primorje/1/2008(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Primorje/1/2008"
/serotype="H5N1"
/specific_host="chicken"
/db_xref="taxon: 529073"
/country="Russia: Vozdvizhenka, Ussuriisky region,
Primorsky krai"
/collection_date="10-Apr-2008"
gene 13..2163
/gene="PA"
CDS 13..2163
/gene="PA"
/codon_start=1
/product="polymerase PA"
/protein_id=" ACD62241.1"
/db_xref="GI:188526730"
/translation="MEDFVRQCFNPMIVELAEKAMKEYGENPKIETNKFAAICTHLEV
CFMYSDFHFIDERGESIIAESGDPNALLKHRFEIIEGRDRTMAWTVVNSI CNTTGVDK
PKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKAD
YTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGT MRRLADQS
LPPNFSSLENFRAYVDGFEPNGCIEGKLSQMSKEVNARIEPFMKTTPRPL RLPDGPPC
SQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMKTFFGWKEPNIVKPH EKGINPNY
LLAWKQVLAELQDIENEEKIPKTKNMKKTSQLKWTLGENMAPEKVDFEDC KDVSDLKQ
YDSDEPEPRSLSSWIQSEFNKACELTDSSWIELDEIGEDIAPIEHIASMR RNYFTAEV
SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL YGFIIKGR
SHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRTAIGQVS RPMFLYVR
TNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFETKS ETWPIGES
PKGVEESSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQALRD NLEPGTFD
LGGLYEAIEECLINDPWVLLNASWFNSFLTHALK"
ORIGIN
1 tactgatcca aaatggaaga ctttgtgcga caatgcttca atccaatgat cgtcgagctt
61 gcggaaaagg caatgaaaga atatggggaa aatccgaaaa tcgaaacgaa caaattcgcc
121 gcaatatgca cacacttaga agtctgcttc atgtattcgg atttccactt tattgatgaa
181 cgaggcgaat caataattgc agaatctggc gatccgaatg cattattgaa acaccgattt
241 gagataattg aagggagaga ccgaacaatg gcttggacag tggtaaatag tatctgcaac
301 accacaggag tcgataagcc taaattcctc ccagatttgt atgactacaa agagaaccga
361 ttcattgaaa ttggagtgac acggagggaa gttcacatat actacctaga aaaagcaaat
421 aagataaaat cagagaagac acacattcac atattctcat tcactggaga ggaaatggcc
481 accaaagcag actatactct tgatgaggag agcagagcaa gaatcaaaac caggctgttc
541 actataagac aagaaatggc cagtaggggt ctatgggatt cctttcgtca atccgagaga
601 ggcgaagaga caattgaaga aagatttgaa atcacaggaa ccatgcgcag gcttgccgac
661 caaagtctcc caccgaactt ctccagcctt gaaaatttta gagcctatgt ggatggattc
721 gaaccgaacg gctgcattga gggcaagctt tctcaaatgt caaaagaagt gaacgccaga
781 attgagccat ttatgaagac aacaccacgc cctctcagac tacccgatgg gcctccctgc
841 tcccagcggt cgaagttctt actgatggat gcacttaaat taagtatcga agatccaagc
901 catgaggggg aaggtatacc actatatgat gcaatcaaat gcatgaagac atttttcggc
961 tggaaagagc ccaacatcgt aaaaccacat gaaaaaggca taaatcccaa ttacctccta
1021 gcttggaagc aggtgctggc agaactccaa gacattgaaa atgaagagaa aatcccaaaa
1081 acaaagaaca tgaagaaaac aagccaatta aagtggacac ttggtgagaa catggcacca
1141 gaaaaagtag actttgagga ctgcaaagat gttagcgatc taaaacagta tgacagtgat
1201 gaaccagagc ctagatcatt atcaagctgg attcagagcg aattcaacaa agcatgcgaa
1261 ttgacagatt cgagttggat tgaacttgat gaaataggag aagatattgc tccaattgag
1321 cacattgcaa gtatgagaag aaactatttc acagcggaag tgtctcattg cagggctact
1381 gaatacataa tgaagggagt gtatataaat acagccctgt tgaatgcatc ctgtgcagcc
1441 atggatgact tccaactgat tccaatgata agcaagtgca gaaccaaaga aggaagacgg
1501 aagacaaatc tgtatggatt cattataaaa ggaaggtccc atttgaggaa cgacaccgat
1561 gtggtaaatt ttgtgagcat ggaattctct cttactgacc cgaggctgga accacacaag
1621 tgggaaaagt actgtgttct cgagatagga gacatgctcc tacgaactgc aataggccaa
1681 gtgtcaagac ccatgttcct gtatgtgaga accaatggga cttccaagat taagatgaaa
1741 tggggcatgg agatgaggcg atgccttctt caatcccttc aacaaattga gagcatgatt
1801 gaggccgagt cttctgtcaa agagaaagac atgaccaaag aattctttga aaccaaatca
1861 gaaacgtggc caattgggga atcacctaaa ggggtggagg aaagctccat tggaaaggtg
1921 tgcagaacgt tactagcaaa atctgtattc aacagcctgt atgcatctcc acaacttgag
1981 ggattttcag ctgaatcaag aaaattgctt ctcattgttc aggcacttag ggacaacctg
2041 gaacctggaa ccttcgatct tggggggcta tatgaagcaa ttgaggagtg cctgattaat
2101 gatccctggg ttttgcttaa tgcatcttgg ttcaactcct tcctcacaca tgcactgaaa
2161 tagttgtggc aatgctacta tttgctatcc atactgtcca aaaaagta
|
May 23rd, 2008, 01:23 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
PA is closely related to sequences from Japan.
|
May 23rd, 2008, 01:24 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
LOCUS EU672456 2316 bp cRNA linear VRL 21-MAY-2008
DEFINITION Influenza A virus (A/chicken/Primorje/1/2008(H5N1)) polymerase PB1
(PB1) gene, complete cds.
ACCESSION EU672456
VERSION EU672456.1 GI:188526727
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
ORGANISM Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2316)
AUTHORS Usacheva,O.V. and Prilipov,A.G.
TITLE Direct Submission
JOURNAL Submitted (23-APR-2008) Molecular Genetic Laboratory, Ivanovsky
Virology Institute, Russian Academy of Medical Science, Gamalei 16,
Moscow 123098, Russia
FEATURES Location/Qualifiers
source 1..2316
/organism="Influenza A virus
(A/chicken/Primorje/1/2008(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Primorje/1/2008"
/serotype="H5N1"
/specific_host="chicken"
/db_xref="taxon: 529073"
/country="Russia: Vozdvizhenka, Ussuriisky region,
Primorsky krai"
/collection_date="10-Apr-2008"
gene 13..2286
/gene="PB1"
CDS 13..2286
/gene="PB1"
/codon_start=1
/product="polymerase PB1"
/protein_id=" ACD62240.1"
/db_xref="GI:188526728"
/translation="MDVNPTLLFLKVPVQNAISTTFPYTGDPPYSHGTGTGYTMDTVN
RTHQYSEKGKWTTNTETGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAF LEESHPGI
FENSCLETMEIVQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEIFRS NGLTANES
GRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQ RLNKRSYL
IRALTLNTMTKDAERGKLKRRAIATPGMQIRGFVYFVETLARSICEKLEQ SGLPVGGN
EKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYIT RNQPEWFR
NVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLANIDLKYFNDL TKKKIEKI
RPLLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQ SSDDFALI
VNAPNHEGIQAGVDRFYRTCKLVGINMSKKKSYINRTGTFEFTSFFYRYG FVANFSME
LPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYT YRCHRGDT
QIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELM DEDYQGRL
CNPLNPFVSHKEIESVNNAIVMPAHGPAKSMEYDAVATTHSWIPKRNRSI LNTSQRGI
LEDEQMYQKCCNLFEKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFES GRIKKEEF
AEIMKICSTIEELRRQK"
ORIGIN
1 caaaccattt gaatggatgt caacccgact ttacttttct tgaaagtgcc agtgcaaaat
61 gctataagta ccacattccc ttatactgga gaccctccat acagccatgg aacagggaca
121 ggatacacta tggacacagt caacagaaca caccaatatt cggaaaaagg gaagtggaca
181 acaaacacag agactggagc accccaactc aacccgattg atggaccact acctgaggat
241 aatgagccca gtgggtatgc acaaacagat tgtgtattgg aagcaatggc tttccttgaa
301 gaatcccacc cagggatctt tgaaaattcg tgtcttgaaa cgatggaaat tgttcaacaa
361 acaagagtgg ataaactgac ccaaggtcgc cagacttatg actggacatt gaatagaaac
421 caaccggctg cgactgcttt ggccaacact atagaaatct tcagatcaaa cggtctgaca
481 gcaaatgaat ctggacggct gatagatttc ctcaaggatg tgatggaatc aatggataag
541 gaagaaatgg agataacaac acatttccag agaaagagaa gagtaaggga caacatgacc
601 aagaaaatgg taacacaaag aacaataggg aagaaaaaac aaaggctgaa caaaaggagc
661 tacctgataa gagcactgac attgaacaca atgaccaagg atgcagaaag aggcaaattg
721 aagaggcgag caattgcaac acccgggatg caaatcagag gattcgtgta ttttgttgaa
781 acactagcga ggagtatctg tgagaaactt gagcaatctg gactcccagt cggagggaat
841 gagaagaaag ctaaattggc taacgtcgtg aggaagatga tgactaactc acaggatact
901 gaactctcct ttacaattac tggggacaat acaaaatgga atgagaatca aaatcctagg
961 atgtttctgg caatgataac gtacatcaca aggaaccagc cagaatggtt tcgaaatgtc
1021 ttaagcattg cccccataat gttctcaaac aaaatggcga gattagggaa aggatacatg
1081 ttcgaaagta agagcatgaa gttacgaaca caaataccag cagaaatgct tgcaaacatt
1141 gaccttaaat acttcaatga cttaacgaaa aagaaaattg agaagataag acctctatta
1201 atagatggta cagcctcatt gagccctgga atgatgatgg gcatgttcaa catgctgagt
1261 acagtcctag gagtttcaat cctgaatctt ggacagaaaa ggtacaccaa aaccacatat
1321 tggtgggacg ggctccaatc ctctgatgat ttcgctctca tcgtaaatgc accgaatcat
1381 gagggaatac aagcaggggt ggatagattt tataggactt gtaaactagt tgggatcaat
1441 atgagcaaga agaagtctta cataaatcgg acagggacat ttgaattcac gagctttttc
1501 taccgctatg gatttgtagc caatttcagt atggagctgc ccagttttgg agtgtctgga
1561 attaatgaat cggccgacat gagcattggt gttacagtga taaagaacaa tatgataaac
1621 aacgaccttg ggccagcaac agctcagatg gctcttcagc tattcatcaa ggactacaga
1681 tacacatacc gatgccacag gggagatacg caaatccaaa cgaggagatc attcgagctg
1741 aagaagctat gggagcaaac ccgttcaaag gcagggctgt tggtttcaga tggaggacca
1801 aatctataca atatccgaaa tctccatatt cctgaggtct gcttgaaatg ggaattgatg
1861 gatgaagact accagggcag actgtgcaat cctctgaatc cattcgtcag ccataaggaa
1921 attgaatctg tcaataatgc tatagtaatg ccagctcatg gtccagccaa gagtatggaa
1981 tatgatgccg ttgcaaccac acattcatgg attcctaaaa ggaatcgttc cattctcaac
2041 acgagtcaaa ggggaattct tgaggatgag cagatgtacc aaaagtgctg caacctattc
2101 gagaaattct tccccagcag ttcgtatcga aggccagttg gaatttccag catggtggag
2161 gccatggtgt ctcgggcccg aattgacgca cgaattgatt tcgagtctgg gaggatcaag
2221 aaagaagagt ttgctgagat catgaagatc tgttccacca ttgaagagct cagacggcaa
2281 aaatagtgaa tttagcttgt ccttcgtgaa aaaatg
|
May 23rd, 2008, 01:24 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
PB1 closely related to sequences from Japan
|
May 23rd, 2008, 01:25 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
LOCUS EU672455 2316 bp cRNA linear VRL 21-MAY-2008
DEFINITION Influenza A virus (A/chicken/Primorje/1/2008(H5N1)) polymerase PB2
(PB2) gene, complete cds.
ACCESSION EU672455
VERSION EU672455.1 GI:188526725
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
ORGANISM Influenza A virus (A/chicken/Primorje/1/2008(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2316)
AUTHORS Usacheva,O.V. and Prilipov,A.G.
TITLE Direct Submission
JOURNAL Submitted (23-APR-2008) Molecular Genetic Laboratory, Ivanovsky
Virology Institute, Russian Academy of Medical Science, Gamalei 16,
Moscow 123098, Russia
FEATURES Location/Qualifiers
source 1..2316
/organism="Influenza A virus
(A/chicken/Primorje/1/2008(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Primorje/1/2008"
/serotype="H5N1"
/specific_host="chicken"
/db_xref="taxon: 529073"
/country="Russia: Vozdvizhenka, Ussuriisky region,
Primorsky krai"
/collection_date="10-Apr-2008"
gene 16..2295
/gene="PB2"
CDS 16..2295
/gene="PB2"
/codon_start=1
/product="polymerase PB2"
/protein_id=" ACD62239.1"
/db_xref="GI:188526726"
/translation="MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA
LRMKWMMAMKYPITADKRIIEMIPERNEQGQTLWSKTNDAGSDRVMVSPL AVTWWNRN
GPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPGHA DLSAKEAQ
DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERE LVRKTRFL
PVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVR RATVSADP
LASLLEMCHSTQIGGIRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFG GFTFKRTS
GSSFTKEEEVLTGNLQTLKIRVHEGYEEFTMVGQRATAILRKATRRLIQL IVSGRNEQ
SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDA KVLFQNWG
IEPIDNVMGMIGLLPDMTPSTELSLRGVRVSKMGVDEYSSTERVVVSIDR FLRVRDQR
GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWE TVKIQWSQ
DPTMLYNKMEFEPFQSLVPKATRSQYSGFVRTLFQQMRDVLGTFDTVQII KLLPFAAA
PPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLTILGKDAGA LTEDPDEG
TAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVV LVMKRKRD
SSILTDSQTATKRIRMAIN"
ORIGIN
1 tcaaatatat tcaatatgga aagaataaaa gaattaagag atctaatgtc acagtcccgc
61 actcgcgaga tactaacaaa aaccactgtg gaccatatgg ccataatcaa gaaatacaca
121 tcaggaagac aagagaagaa tcctgctctc agaatgaaat ggatgatggc aatgaagtat
181 ccgatcacag cggacaagag aataatagag atgattcctg aaaggaatga acaagggcag
241 acgctctgga gcaagacaaa tgatgctggg tcggacaggg tgatggtgtc ccccctagct
301 gtaacttggt ggaataggaa tgggccgacg acaagtacag ttcattatcc aaaagtttac
361 aaaacatact tcgagaaggt tgaaaggtta aaacatggaa cctttggtcc cgttcatttc
421 cgaaaccaag ttaaaatacg ccgccgagtt gatacaaacc ctggccatgc agatctcagt
481 gctaaagaag cacaagatgt tatcatggaa gttgtcttcc caaatgaagt gggagctaga
541 atattgactt cagagtcgca attgacaata acgaaagaga aaaaagaaga gctccaagac
601 tgtaagattg ctcccttaat ggttgcatac atgttggaga gggaactggt ccgcaaaacc
661 agattcctac cggtagcagg cggaacaagc agtgtgtaca ttgaagtact gcatttgact
721 caaggaacct gctgggaaca gatgtacact ccgggcggag aagtaagaaa tgacgatgtt
781 gaccagagtt tgatcattgc tgccagaaac attgttagga gagcaacggt atcagcggac
841 ccattggcat cactgctgga gatgtgtcac agcacacaaa ttggtgggat aaggatggtg
901 gacatcctta ggcaaaatcc aactgaagaa caagctgtgg atatatgcaa agcagcaatg
961 ggtctgagga tcagttcatc ctttagtttt ggaggtttca ccttcaaaag aacaagtggg
1021 tcatccttca cgaaggaaga ggaagtgctc acgggcaacc tccaaacatt gaaaataaga
1081 gtacatgagg ggtatgaaga attcacaatg gttgggcaga gggcaacagc tatcctgagg
1141 aaagcaacta gaaggctgat tcagttgata gtaagcggaa gaaacgaaca atcaatcgct
1201 gaggcaatca ttgtagcgat ggtgttctca caggaggatt gcatgataaa ggcagtccga
1261 ggcgatctaa atttcgtaaa cagagcaaac caaagattaa accccatgca tcaactcctg
1321 agacattttc aaaaggacgc aaaagtgcta tttcagaatt ggggaattga acccattgat
1381 aatgtcatgg ggatgatcgg attattacct gacatgactc ccagcacaga actgtcactg
1441 agaggagtaa gagttagtaa aatgggagtg gatgaatatt ccagcactga aagagtagtt
1501 gtaagcattg accgcttctt aagggttcga gatcagcggg ggaatgtact cttatctccc
1561 gaagaggtca gcgaaaccca gggaacagag aagttgacaa taacatattc gtcatcaatg
1621 atgtgggaaa tcaacggtcc tgagtcagtg cttgtcaaca cctatcaatg gatcatcaga
1681 aactgggaga ccgtaaaaat tcaatggtct caggacccca cgatgctgta caataagatg
1741 gagttcgaac cgttccaatc cttggtacct aaagctacca gaagtcaata cagtggattt
1801 gtgagaacat tattccaaca aatgcgtgac gtactgggga catttgatac tgtccagata
1861 ataaagctgc taccatttgc agcagcacca cctgagcaga gcagaatgca gttttcttct
1921 ctaactgtga atgtaagagg ctcaggaatg agaatacttg taaggggcaa ttctcctgtg
1981 ttcaactaca ataaggcaac caaaaggctt accattcttg gaaaggacgc aggtgcatta
2041 acagaggatc cagacgaggg gacagccgga gtggaatctg cagtactgag gggattccta
2101 attctaggca aggaggacaa aagatatgga ccagcattga gcatcaatga actgagcaat
2161 cttgcaaaag gggagaaagc taatgtgctg ataggacaag gagacgtagt gttggtaatg
2221 aaacggaaac gggactctag catacttact gacagccaga cagcgaccaa aagaattcgg
2281 atggccatca attagtgtcg aattatttaa aaacga
|
May 23rd, 2008, 01:26 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
PB2 closley related the sequences from Japan.
|
May 23rd, 2008, 01:40 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
So far I haven't found HA or MP but the six genes listed so far are virtually identical to the two sets of sequences from Japan.
|
May 23rd, 2008, 01:43 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
Quote:
Originally Posted by Commonground
Dr Niman, I can't seem to find how many chickens were tested/found?
|
28 susceptible chickens (21 cases), 8 susceptible guinea fowls (7 cases), 3 susceptible muscovy ducks (no cases) and 3 susceptible ducks (no cases) in a backyard. Poultry in the village were not vaccinated.
http://www.oie.int/wahid-prod/report...411_155116.pdf
Last edited by sharon sanders; May 23rd, 2008 at 04:14 PM.
Reason: format only
|
May 23rd, 2008, 01:53 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
Quote:
Originally Posted by niman
NA is closely related to sequences from Japan
|
Differs from Japan at 2 positions.
|
May 23rd, 2008, 02:21 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
|
May 23rd, 2008, 02:55 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
Quote:
Originally Posted by niman
PB2 closley related the sequences from Japan.
|
There is only one difference in the PB2 sequences. The Russian sequence has the three consecutive North American polymorphisms.
|
May 23rd, 2008, 03:58 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
|
May 23rd, 2008, 04:03 PM
|
 |
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: H5N1 From Primorie (2008)
Quote:
Originally Posted by niman
|
Commentary
Global Expansion of Fujian H5N1 Confirmed
Recombinomics Commentary 20:41
May 23, 2008
The match between the Fujian H5N1 sequences in Primorsky, Russia with multiple sequences from northern Japan and the record outbreak in South Korea leaves little doubt that a global expansion of Fujian clade 2.3 sequences has begun. H5N1 has never been reported in northern Japan or southeastern Russia and prior outbreaks in South Korea and Japan have been at the end of the year when birds are migrating into the region. The current outbreaks are in the spring, when birds are migrating out of the region.
The tracks of outbreaks (see satellite map) signal movement to the north and will likely migrate Fujian H5N1 into new regions. Although such movements may have happened previously, but not detected, the record levels in South Korea and the multiple locations in northern Japan suggest that the current levels are higher.
This expansion has much in common with the expansion of the Qinghai (clade 2.2) strain three years at Qinghai Lake. Those sequences migrated north to Siberia and Mongolia over the summer, and then spread to Europe, the Middle East, and Africa. To date, all H5N1 west of China has been clade 2.2. Clade 2.2 also expanded into south Asia as well as South Korea / Japan in 2006/2007.
The current outbreaks represent the first reports of the Fujian strain (clade 2.3) in Japan, South Korea, or Russia. The movement into northern Japan signals movement into North America in the upcoming weeks via the East asian flyway. Similarly, the movement into Russia signals migration into northeastern Russia, which will also feed into North America. The H5N1 in South Korea signals movement into Siberia, where there will be mixing with clade 2.2 from Europe, the Middle East, and Africa. This will lead to more rapid evolution via recombination between clade 2.2 and clade 2.3.
All public human sequences from China have been the Fujian strain, and the clade 2.3.4 sequences from the public sequences from Japan and Russia are most closely related to sequences from a human case in Guangdong province in 2006. Thus, these clade 2.3 sequences have been confirmed in human cases in China and the soldier in South Korea was H5 positive, although Korea has denied the infection because of false negatives for N1.
This global expansion has been confirmed with Fujian sequences in three countries that have never reported Fujian sequences previously. Surveillance programs, especially those that focus on healthy wild birds have been abysmal, in part because cloacal swabs are collected, and the methodologies used have been fatally flawed.
Recent results in Japan have also highlighted problems linked to false negatives generated by the rapid tests, which have a notoriously low sensitivity. Testing of dead and dying whooper swans in Japan has been successful, including testing on samples that have previously been negative by rapid test.
A more serious surveillance effort is required to accurately map the transport and transmission of Fujian H5N1 by long range migratory birds. The prompt release of sequences by labs in Japan and Russia should serve as a model for this surveillance.
The reliance on false negatives and the hoarding of sequences remain hazardous to the world’s health.
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|
May 23rd, 2008, 05:15 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
Quote:
Originally Posted by niman
PB1 closely related to sequences from Japan
|
Two differences in PB1
|
May 23rd, 2008, 05:54 PM
|
|
Resident
|
|
Join Date: Aug 2006
Posts: 670
|
|
Re: H5N1 From Primorie (2008)
This Russian virus appears to also be closely related to "A/migratory duck/Jiangxi/2136/2005" as to some of these gene segments, and Jiangxi has the GERRRKKR HA cleavage marking.
Perhaps a reassortant of Qinghai and Fujian has taken place. HA from Primorie would be interesting, especially if the multiple amino acids at the cleavage site resemble Qinghai.
|
May 23rd, 2008, 11:22 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
Quote:
Originally Posted by Mamabird
This Russian virus appears to also be closely related to "A/migratory duck/Jiangxi/2136/2005" as to some of these gene segments, and Jiangxi has the GERRRKKR HA cleavage marking.
Perhaps a reassortant of Qinghai and Fujian has taken place. HA from Primorie would be interesting, especially if the multiple amino acids at the cleavage site resemble Qinghai.
|
This Russian virus is virtually identical to the isolates from Japan, which have a clade 2.3.2 HA and clade 2.3.4 for the other 7 gene segments. These are clearly Fujian isolates related to wild birds in Hong Kong (clade 2.3.4) in 2006 and 2007.
|
May 24th, 2008, 04:12 AM
|
 |
Registered User
|
|
Join Date: Feb 2006
Location: germany
Posts: 8,620
|
|
Re: H5N1 From Primorie (2008)
the little egret/HK/06 is closest in segments 2,3,5,7,8
with a MRCAD (most recent common anchestor date) in 2005 for those segments
A/Dk/Fujian/1734/05 is closest in segments 2,3 with a MRCAD in 2003-2004
A/Ck/Korea/ES/03 has MRCAD 2002-2003 in segments 5,7,8
and ~2001 in segments 1,2
But we can't so well compare the Fujian-strain with the Qinghai-strain.
Much more holes in Fujian data, fewer sequences available,
and frequent reassortments
inside the Fujian-strain as well as with other H5N1
we might even give clade-names to each segment separately
---edit1-----------
15 differences in Primorje vs. Hokkaido for a MRCAD of early February 2008.
I can't say from the sequences from where to where the virus went
----edit2---------
A/Dk/Jiangxi/2136 has 38,32,48,48,24,49,13,27 0/00 difference to the Hokkaido swan in the 8 segments
to compare: A/Ck/Israel/1055/3.Jan.2008 has 13,9,10,19,11,12,7,9 0/00 differences to original Qinghai,10.Feb.2005
Jiangxi has 11,10,6,17,8,17,4,15 0/00 difference to Korea/ES/03, so it could be a direct descendant
(or more likely closely related to one) in segments 3,5,7
Last edited by gsgs; May 24th, 2008 at 10:13 AM.
|
May 24th, 2008, 08:45 AM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
Quote:
Originally Posted by Mamabird
This Russian virus appears to also be closely related to "A/migratory duck/Jiangxi/2136/2005" as to some of these gene segments, and Jiangxi has the GERRRKKR HA cleavage marking.
Perhaps a reassortant of Qinghai and Fujian has taken place. HA from Primorie would be interesting, especially if the multiple amino acids at the cleavage site resemble Qinghai.
|
As noted in travel logs for the sequences from Japan, these sequences have acquired a few polymorphisms that previously were just Qinghai. There is undoubted mixing of the sequences from prior encounters. However, the two lineages are easily distinguished and all 8 Japanese segments are are Fujian, although the HA is Fujian clade 2.3.2, while the other seven are 2.3.4. The 2.3.2 sequence has a clear Fujian cleavage site, RERRRKR (dropped a K). The earlier clade 2.3.2 sequences were in Vietnam in 2005 and they also hade M230I. There are more recent sequences from wild birds in Hong Kong, but those sequences haven't been released (probably because they a reassortants and held for publication). However, the WHO phylogenetic tree on vaccine targets has one sequence and it (common magpie) maps to the same location as the Japanese sequences, so it is a closer match (it also has many changes from 2005). The other gene segments are close to the 2006 wld bird sequences from Hong Kong. Each year wild birds die in Hong Kong and they are good indicators of what is flying around in the East Asian flyway.
|
May 24th, 2008, 04:28 PM
|
|
Retired
|
|
Join Date: Feb 2006
Posts: 20,294
|
|
Re: H5N1 From Primorie (2008)
|
May 25th, 2008, 05:36 PM
|
|
Editor, Senior Moderator
|
|
Join Date: Mar 2006
Posts: 8,703
|
|
Re: H5N1 From Primorie (2008)
Quote:
Originally Posted by niman
|
Commentary
Fujian H5N1 Evolution and Global Expansion
Recombinomics Commentary 21:22
May 24, 2008
The recent sequence data from Japan and Russia and the reported identities of 99.7% or greater with the isolates from South Korea clearly demonstrate a global expansion of the Fujian (clade 2.3) strain of H5N1. None of these countries has previously reported the Fujian strain, raising concerns that the strain is poised for a dramatic global expansion similar to the expansion of clade 2.2 which began in the spring of 2005 at Qinghai Lake. Clade 2.2 migrated to Chany Lake in Novosibirsk in Siberia and the Erhel Lake in Mongolia in the summer of 2005, and then spread to Europe, the Middle East, and Africa in late 2005 / early 2006 as well as south Asia in the same time frame.
Clade 2.3 traces back to an isolate from ducks being smuggled from Fujian province to Formosa in late 2003, A/duck/China/E319-2/03. In contrast to the consensus HA cleavage site of RERRRKKR, the Fujian strain was missing a K, producing the cleavage site of RERRRK_R. The strain expanded in China and a more evolved version, A/duck/Fujian/1734/2005 was isolated in the spring of 2005 and it spread throughout southern China in the 2005/2006 season. This Fujian strain was also found in wild birds in Hong Kong in early 2006 as well as isolates from Laos and Malaysia, signaling movement into southeast Asia. In 2005 China reported its first human case and it, like virtually all human cases in China was clade 2.3,
As more sequences were developed, clade 2.3 was divided into multiple sub-clades. The 2003 duck isolate was clade 2.3.2, as were poultry isolates in Vietnam in 2005. The vaccine target for clade 2.3.2 is A/common magpie/ Hong Kong/5052/2007, although the sequences from this isolate have not been made public. However, it is in the WHO phylogenetic tree of vaccine targets, and maps to the same location as the HA sequences from Japan, and presumably Russia and South Korea.
The largest Fujian sub-clade is 2.3.4, which includes the 2005 isolate from Fujian province as well as all clade 2.3 human cases in China. Human cases from Laos and Vietnam are also clade 2.3.4. The sequences from Japan and Russia (and presumably South Korea), other than HA are clade 2.3.4 and are most closely related to a human isolate from Guangdong Province, A/China/GD02/2006, which is closely related to the wild bird sequences from Hong Kong in 2006.
Thus, the sequences in Japan (and presumably Russia and South Korea) are reassortants, with an HA from clade 2.3.2 and the other seven gene segments from clade 2.3.4. The H5 infection of the soldier in South Korea represents the first reported human infection involving HA from clade 2.3.2.
Thus, it is the Fujian reassortant of clade 2.3.2 / clade 2.3.4 that is poised to spread into North America via the East Asia flyway and poised to mix with clade 2.2 in Mongolia via clade 2.3 infected wild birds in South Korea which migrate to Mongolia during the summer.
This global expansion of Fujian clade 2.3 is an increasing cause for concern.
.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
|
|
|
|
Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
|
|
|
| Thread Tools |
Search this Thread |
|
|
|
| Display Modes |
 Linear Mode
|
Posting Rules
|
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts
HTML code is On
|
|
|
Disclaimer:
The reader is responsible for discerning the validity, factuality or implications of information posted here, be it fictional or based on real events. Moderators on this forum make every effort to review the material posted on this site however, it is not realistically possible for our staff to manually review each post.
The content of posts on this site, including but not limited to links to other web sites, are the expressed opinion of the original authors or posters and are not endorsed by, or representative of the opinions of, the owners or administration of this website. The posts on this website are the opinion of the specific author or poster and should not be construed as statements of advice or factual information.
Not all posts on this website are intended as truthful or factual assertion by their authors. NO posts on this website should be considered factual information on face value alone. Users are encouraged to USE DISCERNMENT and do their own follow up research while reading and posting on this website. FluTrackers.com Inc. reserves the right to make changes to, corrections and/or remove entirely at any time posts made on this website without notice. In addition, FluTrackers.com Inc. disclaims any and all liability for damages incurred directly or indirectly as a result of a post on this website.
This site is provided "as is" without warranty of any kind, either expressed or implied. You should not assume that this site is error-free or that it will be suitable for the particular purpose which you have in mind when using it. In no event shall FluTrackers.com Inc. be liable for any special, incidental, indirect or consequential damages of any kind, or any damages whatsoever, including, without limitation, those resulting from loss of use, data or profits, whether or not advised of the possibility of damage, and on any theory of liability, arising out of or in connection with the use or performance of this site or other documents which are referenced by or linked to this site.
Finally, FluTrackers.com Inc. reserves the right to delete, correct, or make changes to any post on this website without notice at any time for any reason.
Fair Use Notice:
This site may contain copyrighted material the use of which has not always been specifically authorized by the copyright owner. Users may make such material available in an effort to advance awareness and understanding of issues relating to public health, civil rights, economics, individual rights, international affairs, liberty, science & technology, etc. We believe this constitutes a 'fair use' of any such copyrighted material as provided for in section 107 of the US Copyright Law. In accordance with Title 17 U.S.C.Section 107, the material on this site is distributed to those who have expressed a prior interest in receiving the included information for research and educational purposes.
In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article. Please remember you are responsible for what you post on the internet and you could be sued by the original copyright holder if you do not honor these rules.
If you are a legal copyright holder or a designated agent for such and you believe a post on this website falls outside the boundaries of "Fair Use" and legitimately infringes on yours or your clients copyright
we may be contacted concerning copyright matters at:
FluTrackers.com Inc.
c/o Sharon Sanders
1676 Hibiscus Avenue
Winter Park, Florida 32789
Phone: 407-406-3037
E-Mail: flutrackers@earthlink.net
In accordance with section 512 of the U.S. Copyright Act our contact information has been registered with the United States Copyright Office. "Safe Harbor" noticing procedures as outlined in the DMCA apply to this website concerning all 3rd party posts published herein.
If notice is given of an alleged copyright violation we will act expeditiously to remove or disable access to the material(s) in question.
All 3rd party material posted on this website is the copyright of the respective owners / authors. FluTrackers.com Inc. makes no claim of copyright on such material.
For more information please visit:
http://www.law.cornell.edu/uscode/17/107.shtml
Please be aware any communications sent complaining about a post on this website may be posted publicly at the discretion of the administration.
FluTrackers Does Not Provide Any Medical Advice:
FluTrackers, Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster.
The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website.
By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
By using and/or accessing this site, either passively or actively, you are agreeing to all of the above conditions. Also, by using and/or accessing this site, either passively or actively, you agree to conduct all business and legal affairs related to this website in the jurisdiction of Flutrackers.com Inc. which is registered in Central Florida, USA.
These Disclaimers are subject to change at anytime.
Email the Webmaster with questions or comments about this site at flutrackers@earthlink.net
All times are GMT -4. The time now is 04:53 PM.
|
