medpedia.com FluTrackers

Tracking Infectious Diseases since 2006

FluTrackers.com Inc. is a 501(c)(3) charity

Official PayPal Seal
H1N1 Swine Flu Information Información Gripe H1N1 Information Grippe H1N1 Influenza H1N1 Informazioni FluTrackers Latest Posts

www www.flutrackers.com



Go Back   FluTrackers > Genetic Tracking & Scientfic Analysis of Pandemic Influenza & Other Diseases > Southeast Asia - Excl. China and Indonesia

Reply
 
Thread Tools Search this Thread Display Modes
  #1  
Old March 29th, 2009, 01:13 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default H5N1 Vietnam 2008 Clade 7

LOCUS FJ842481 1713 bp cRNA linear VRL 27-MAR-2009
DEFINITION Influenza A virus (A/chicken/Vietnam/NCVD-03/2008(H5N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION FJ842481
VERSION FJ842481.1 GI:225697337
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Vietnam/NCVD-03/2008(H5N1))
ORGANISM Influenza A virus (A/chicken/Vietnam/NCVD-03/2008(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1713)
AUTHORS Nguyen,T., Davis,T., Stembridge,W., Shu,B., Balish,A., Inui,K.,
Do,H., Ngo,H., Wan,X.-F., McCarron,M., Lindstrom,S., Cox,N.,
Nguyen,C., Klimov,A. and Donis,R.
TITLE Characterization of a highly pathogenic avian influenza H5N1 virus
sublineage in poultry seized at ports of entry into Vietnam
JOURNAL Virology (2009) In press
REFERENCE 2 (bases 1 to 1713)
AUTHORS Nguyen,T., Davis,T., Stembridge,W., Shu,B., Balish,A., Inui,K.,
Do,H., Ngo,H., Wan,X.-F., McCarron,M., Lindstrom,S., Cox,N.,
Nguyen,C., Klimov,A. and Donis,R.
TITLE Direct Submission
JOURNAL Submitted (19-MAR-2009) Influenza Division, CDC, 1600 Clifton Rd.,
Atlanta, GA 30333, USA
FEATURES Location/Qualifiers
source 1..1713
/organism="Influenza A virus
(A/chicken/Vietnam/NCVD-03/2008(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Vietnam/NCVD-03/2008"
/serotype="H5N1"
/isolation_source="cloacal swab"
/host="chicken"
/db_xref="taxon:629212"
/segment="4"
/country="Viet Nam"
/collection_date="2008"
gene 1..1713
/gene="HA"
CDS 1..1713
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="ACO07038.1"
/db_xref="GI:225697338"
/translation="MEKIVLLLAIISLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCNLDGVKPLILKDCSVAGWLLGNPMCDEFLNVSEWSY IVEKASPA
NGLCYPGDFNDYEELKHLLNRITHLKKIKIIPKSYWSNHEASSGVSAACS YMGEPSFF
RNVVWLIKKNNTYPPIKVNYTNTNQEDLLVLWGIHHPNNEAEQIQIYQNL ITHISVGT
STLNQRLIPKIATRSKVNGQSGRMEFFWTILKPNDSINFDSNGNFIAPEY AYIVKKGD
SAIMKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRL VLATGLRN
APQREREGGRRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAA DKESTQKA
IDGITNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTY NAELLVLM
ENERTLDFHDSNVKNLYEKVRLQLRDNAKELGNGCFEFYHKCDNECMESV RNGTYDYS
QYSEEARLSREEINGVKLESMVTYQILSIYSTVASSLALAIMVAGLSLWM CSNGSLQC
RICI"
ORIGIN
1 atggagaaaa tagtgcttct tcttgcaata atcagccttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcgacagag caggttgaca caataatgga aaagaacgtt
121 actgttacac atgctcaaga catactggag aagacacaca acgggaagct ctgcaaccta
181 gatggagtga agcctctaat tctaaaagac tgtagtgtag ctggatggct cctcgggaac
241 ccaatgtgtg acgaatttct caatgtgtca gaatggtctt acatagtgga gaaggccagt
301 ccagccaatg gcctctgtta cccaggggat ttcaatgact atgaagaact gaaacaccta
361 ttaaacagaa taacacatct taagaaaatt aagatcatcc ccaaaagtta ttggtccaat
421 catgaagcct catcaggggt gagcgcagca tgttcctata tgggggagcc ctcctttttc
481 agaaatgtgg tatggcttat caaaaagaat aatacatacc caccaataaa ggtgaactac
541 accaatacca atcaagaaga tcttttggta ctgtggggga ttcaccatcc caataatgag
601 gcagagcaga tacagatcta tcaaaaccta atcacccata tttcagttgg aacatcaaca
661 ctaaaccaga gattgatacc aaaaatagct actagatcca aagtgaacgg gcaaagtgga
721 agaatggagt tcttctggac aattttaaag ccgaatgatt ctatcaattt cgatagcaat
781 ggaaatttca ttgctccaga atatgcctac attgtcaaga aaggggactc ggcaattatg
841 aaaagtgaat tggagtatgg taactgcaac accaagtgtc aaactccaat gggggcgata
901 aattctagta tgccattcca caacatacac cctctcacca tcggggaatg ccccaaatat
961 gtgaagtcaa acagattagt cctcgcgact ggactcagaa atgcccctca aagagaaaga
1021 gaggggggaa gaagaagaaa aagaggacta tttggagcca tagcagggtt tatagaggga
1081 ggatggcagg gaatggtaga tggttggtat gggtaccacc atagcaatga gcaggggagt
1141 gggtacgctg cagacaaaga atccactcaa aaggcaatag atggaatcac taataaggtc
1201 aactcgatca ttgacaaaat gaacactcaa tttgaggccg ttggaaggga atttaataac
1261 ttagagagga gaatagaaaa tttaaacaaa aagatggagg acggattcct agatgtctgg
1321 acttataacg ctgaacttct ggttctcatg gaaaatgaga gaactctaga ctttcatgac
1381 tcaaatgtca agaaccttta cgaaaaggtc cgactacagc ttagggataa tgcaaaggag
1441 ctgggtaacg gttgtttcga gttctaccac aaatgtgata atgaatgtat ggaaagtgta
1501 agaaacggaa cgtatgacta ctcgcagtat tcagaagaag caagactaag cagagaggaa
1561 ataaatggag taaaattgga atcaatggta acttaccaaa tactgtcaat ttattcaaca
1621 gtggcgagtt ccctagcatt ggcaatcatg gtggctggtc tatctttatg gatgtgctcc
1681 aatggatcgt tacaatgcag aatttgcatt tga
Reply With Quote
  #2  
Old March 29th, 2009, 02:11 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

Sequence has a 3 BP deletion (downstream from Shanxi/2 deletion) as well as 9 BP insertion at HA cleavages site, reflection clade 7 instability in Northern Vietnam ex-China.
Reply With Quote
  #3  
Old March 29th, 2009, 09:12 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

Quote:
Originally Posted by niman View Post
Sequence has a 3 BP deletion (downstream from Shanxi/2 deletion) as well as 9 BP insertion at HA cleavages site, reflection clade 7 instability in Northern Vietnam ex-China.
Earlier clade 7 sequence from Vietnam has a 3 BP insertion to create novel cleavage site REGGRRRKR (the above sequence matches but has a 6 BP duplication to create REREGGRRRKR).

It is VERY likely that both of these sequences originated in China.
Reply With Quote
  #4  
Old March 29th, 2009, 09:13 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

Note title:

TITLE Characterization of a highly pathogenic avian influenza H5N1 virus
sublineage in poultry seized at ports of entry into Vietnam
Reply With Quote
  #5  
Old March 30th, 2009, 05:55 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

Commentary at

http://www.recombinomics.com/News/03..._Unstable.html
Reply With Quote
  #6  
Old March 30th, 2009, 03:07 PM
AlaskaDenise's Avatar
AlaskaDenise AlaskaDenise is offline
Editor, Senior Moderator
 
Join Date: Mar 2006
Posts: 8,703
Default Re: H5N1 Vietnam 2008 Clade 7

Quote:
Originally Posted by niman View Post
Commentary

Unstable Clade 7 H5N1 In China Raises Concerns

Recombinomics Commentary 10:34
March 30, 2009

A recent clade 7 HA sequence from a chicken in Vietnam, A/chicken/Vietnam/NCVD-03/2008 was released at Genbank under the title, "Characterization of a highly pathogenic avian influenza H5N1 sublineage in poultry seized at ports of entry into Vietnam". It was proposed as a vaccine target in the recent WHO update because it was antigenically distinct from another recent clade 7 target, A/chicken/Vietnam/NCVD-016/2008, which was isolate in northern Vietnam near the border with China. Both of these sequences have a cleavage site similar to clade 7 isolated in 2006 in China, except the cleavage site has a 3 BP insertion, encoding for an additional basic amino acid.

However, the recent sequence also has a duplication of sequences encoding the two amino acids at the beginning of the cleavage site, creating the novel cleavage site, REREGGRRRKR. The sequence also has an addition 3 BP deletion, which is distinct from the 3 BP deletion found in earlier clade 7 isolates from China, as well as clade 2.2 isolates in Egypt.

The selection of two 2008 clade 7 targets from Vietnam is unusual, but follows a spate of cases in China in January. These cases followed confirmed clade 7 outbreaks in poultry in Jiangsu in December, 2008 and strongly suggest that most of the human cases in China were clade 7.

The sequences form these patients have not been released and have only been described in general terms in reports from China. The WHO report was silent on all cases from China except for two that were the Fujian strain (clade 2.3.2 and 2.3.4), further supporting concerns that vaccine resistant clade 7 is widely circulating in China.

The recent sequences from northern Vietnam demonstrate considerable genetic instability that involves a large number of non-synonymous changes as well as insertions and deletions in the HA sequence.

Release of sequences from the Jiangsu poultry outbreaks in China, as well as recent human cases in China and northern Vietnam would be useful.

.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
Reply With Quote
  #7  
Old March 30th, 2009, 03:12 PM
AlaskaDenise's Avatar
AlaskaDenise AlaskaDenise is offline
Editor, Senior Moderator
 
Join Date: Mar 2006
Posts: 8,703
Default Re: H5N1 Vietnam 2008 Clade 7

Quote:
REREGGRRRKR
These are all cleavage site positions?

If so, that's more than in the past, so is H5N1 adapting to be cleaved my more enzymes with one strain?

.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
Reply With Quote
  #8  
Old March 30th, 2009, 03:23 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

Quote:
Originally Posted by AlaskaDenise View Post
These are all cleavage site positions?

If so, that's more than in the past, so is H5N1 adapting to be cleaved my more enzymes with one strain?

.
Cleavage is after an R or K.
Reply With Quote
  #9  
Old March 30th, 2009, 03:31 PM
AlaskaDenise's Avatar
AlaskaDenise AlaskaDenise is offline
Editor, Senior Moderator
 
Join Date: Mar 2006
Posts: 8,703
Default Re: H5N1 Vietnam 2008 Clade 7

Quote:
Originally Posted by niman View Post
Cleavage is after an R or K.
???

Could you provide more detail?

.
__________________
"The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation
Reply With Quote
  #10  
Old March 30th, 2009, 04:28 PM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

Commentary

http://www.recombinomics.com/News/03..._Cleavage.html
Reply With Quote
  #11  
Old April 6th, 2009, 07:50 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

1: FJ538950
Reports

Links
Influenza A virus (A/chicken/Vietnam/NCVD-093/2008(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds
gi|218137997|gb|FJ538950.1|[218137997]
2: FJ538949
Reports

Links
Influenza A virus (A/chicken/Vietnam/NCVD-093/2008(H5N1)) segment 6 neuraminidase (NA) gene, partial cds
gi|218137995|gb|FJ538949.1|[218137995]

3: FJ538948
Reports

Links
Influenza A virus (A/duck/Vietnam/NCVD-100/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds
gi|218137992|gb|FJ538948.1|[218137992]

4: FJ538947
Reports

Links
Influenza A virus (A/duck/Vietnam/NCVD-100/2007(H5N1)) segment 6 neuraminidase (NA) gene, partial cds
gi|218137990|gb|FJ538947.1|[218137990]
Reply With Quote
  #12  
Old April 6th, 2009, 07:50 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

LOCUS FJ538949 1349 bp cRNA linear VRL 04-APR-2009
DEFINITION Influenza A virus (A/chicken/Vietnam/NCVD-093/2008(H5N1)) segment 6
neuraminidase (NA) gene, partial cds.
ACCESSION FJ538949
VERSION FJ538949.1 GI:218137995
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Vietnam/NCVD-093/2008(H5N1))
ORGANISM Influenza A virus (A/chicken/Vietnam/NCVD-093/2008(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1349)
AUTHORS Deyde,V.M., Nguyen,T., Bright,R.A., Balish,A., Shu,B.,
Lindstrom,S., Klimov,A.I. and Gubareva,L.V.
TITLE Detection of molecular markers of antiviral resistance in influenza
A (H5N1) viruses using a pyrosequencing method
JOURNAL Antimicrob. Agents Chemother. 53 (3), 1039-1047 (2009)
PUBMED 19124660
REFERENCE 2 (bases 1 to 1349)
AUTHORS Davis,T. and Nguyen,T.
TITLE Direct Submission
JOURNAL Submitted (09-DEC-2008) MVVB, CDC, 1600 Clifton Rd., Atlanta, GA
30333, USA
FEATURES Location/Qualifiers
source 1..1349
/organism="Influenza A virus
(A/chicken/Vietnam/NCVD-093/2008(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Vietnam/NCVD-093/2008"
/serotype="H5N1"
/host="chicken"
/db_xref="taxon:581024"
/segment="6"
/country="Viet Nam"
/collection_date="2008"
gene 1..>1349
/gene="NA"
CDS 1..>1349
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="ACK57573.1"
/db_xref="GI:218137996"
/translation="MNPNQKIITIGSICVVIGIVSLMLQIGNMISIWVSHSIQTENQC
QAESISNTKFLTEKAVASVTLMGNSSLCPISGWAVHSKDNSIRIGSKGDV FVIREPFI
SCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPVGEAPSPYNS RFESVAWS
ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESE CACVNGSC
FTVMTDGPSNGQASYKIFKLEKGKVVKSVELDAPNYHYEECSCYPDAGEI TCVCRDNW
HGSNGPWVSFNHYLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGV KGFSFKYG
NGVWIGRTKSTNSRSGFEMIWDPNGWTGTDSSFSVKQDIVAITDWSGYSG SFVQHPEL
TGLDCIRPCFWVELVRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAE VPFTIDK"
ORIGIN
1 atgaatccaa atcagaagat aataaccatc ggatcaatct gtgtggtaat tggaatagtt
61 agcttaatgt tacaaattgg gaacatgatc tcaatatggg tcagtcattc aattcagaca
121 gagaatcaat gccaagctga atcgatcagc aatactaaat ttctcactga gaaggctgtg
181 gcttcagtaa cattaatggg caattcatct ctttgcccca ttagcggatg ggctgtacac
241 agtaaggaca acagcataag gatcggttcc aagggggatg tgtttgttat aagagagccg
301 ttcatctcat gctcccactt ggaatgcaga actttctttt tgactcaggg agccttgctg
361 aatgacaagc actccaatgg gactgtcaaa gacagaagcc ctcacagaac attaatgagt
421 tgtcctgtgg gtgaggctcc ctctccatat aactcaaggt ttgagtctgt tgcttggtca
481 gcaagtgctt gccatgatgg caccagttgg ttgacaattg gaatttctgg cccagacaat
541 ggggctgtgg ctgtattgaa atacaatggt ataataacag acactatcaa aagttggagg
601 aacaacatac tgagaactca agagtctgaa tgtgcatgtg taaatggctc ttgctttact
661 gtaatgactg atggaccaag taatgggcag gcatcatata agatcttcaa attggaaaaa
721 gggaaagtgg ttaaatcagt tgaattggat gctcctaatt atcactatga ggaatgctcc
781 tgttatcctg atgctggcga aatcacatgt gtgtgcaggg ataattggca tggctcaaat
841 gggccatggg tatctttcaa tcactatttg gagtatcaaa taggatatat atgcagtgga
901 gttttcggag acaatccacg ccccaatgat ggaacaggga gctgtggtcc ggtgtcccct
961 aatggggcat atggggtaaa agggttttca tttaaatacg gcaatggtgt ttggatcggg
1021 agaaccaaaa gcactaattc caggagcggc tttgaaatga tttgggatcc gaatgggtgg
1081 actggaacgg acagcagctt ttcggtgaag caagatatcg tagcaataac tgattggtca
1141 ggatatagcg ggagttttgt ccagcatcca gaactgacag gattagattg cataagacct
1201 tgtttctggg ttgagttagt cagagggcgg cccaaagaga gcacaatctg gactagtggg
1261 agcagcatat ccttttgtgg tgtaaatagt gacactgtgg gttggtcttg gccagacggt
1321 gctgaggtgc cattcaccat tgacaagta
Reply With Quote
  #13  
Old April 6th, 2009, 07:52 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

The above isolate (clade 7) is in the HA tree of WHO vaccine targets and the above NA sequence has OBVIOUS recombination (with vaccine resistant clade 2.2 in Egypt).
Reply With Quote
  #14  
Old April 6th, 2009, 08:31 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

NA travel log

gb|FJ538949.1| Influenza A virus (A/chicken/Vietnam/NCVD-093/... 38.2 0.17
gb|FJ719836.1| Influenza A virus (A/chicken/Manipur/NIV9743/2... 38.2 0.17
gb|FJ667187.1| Influenza A virus (A/chicken/Domodedovo/MK/200... 38.2 0.17
gb|FJ688369.1| Influenza A virus (A/chicken/Egypt/24NLQP-CLEV... 38.2 0.17
gb|FJ688367.1| Influenza A virus (A/chicken/Egypt/17NLQP-CLEV... 38.2 0.17
gb|FJ688366.1| Influenza A virus (A/chicken/Egypt/15NLQP-CLEV... 38.2 0.17
gb|FJ688365.1| Influenza A virus (A/chicken/Egypt/10NLQP-CLEV... 38.2 0.17
gb|FJ688364.1| Influenza A virus (A/chicken/Egypt/4NLQP-CLEVB... 38.2 0.17
gb|FJ688363.1| Influenza A virus (A/chicken/Egypt/1NLQP-CLEVB... 38.2 0.17
emb|AM911101.1| Influenza A virus (A/Anas acuta/Slovenia/470/... 38.2 0.17
emb|AM911091.1| Influenza A virus (A/Ardea cinerea/Slovenia/1... 38.2 0.17
emb|AM911086.1| Influenza A virus (A/cygnus olor/Slovenia/156... 38.2 0.17
emb|AM911074.1| Influenza A virus (A/Mergus albellus/Slovakia... 38.2 0.17
emb|AM911073.1| Influenza A virus (A/Peregrine falcon/Slovaki... 38.2 0.17
gb|EU636810.1| Influenza A virus (A/great crested grebe/Basqu... 38.2 0.17
gb|FJ461659.1| Influenza A virus (A/Egypt/3401-NAMRU3/2008(H5... 38.2 0.17
gb|FJ461658.1| Influenza A virus (A/Egypt/3300-NAMRU3/2008(H5... 38.2 0.17
gb|FJ461652.1| Influenza A virus (A/Egypt/10217-NAMRU3/2007(H... 38.2 0.17
gb|FJ461651.1| Influenza A virus (A/Egypt/10216-NAMRU3/2007(H... 38.2 0.17
gb|FJ461650.1| Influenza A virus (A/Egypt/10215-NAMRU3/2007(H... 38.2 0.17
gb|FJ461648.1| Influenza A virus (A/Egypt/6251-NAMRU3/2007(H5... 38.2 0.17
gb|FJ461644.1| Influenza A virus (A/Egypt/2751-NAMRU3/2007(H5... 38.2 0.17
gb|FJ461641.1| Influenza A virus (A/Egypt/2630-NAMRU3/2007(H5... 38.2 0.17
gb|FJ461632.1| Influenza A virus (A/Egypt/1731-NAMRU3/2007(H5... 38.2 0.17
gb|FJ461631.1| Influenza A virus (A/Egypt/1604-NAMRU3/2007(H5... 38.2 0.17
gb|FJ461629.1| Influenza A virus (A/Egypt/2991-NAMRU3/2006(H5... 38.2 0.17
gb|FJ461628.1| Influenza A virus (A/Egypt/2947-NAMRU3/2006(H5... 38.2 0.17
gb|EU889100.1| Influenza A virus (A/herring gull/Sweden/V1116... 38.2 0.17
gb|EU889099.1| Influenza A virus (A/tufted duck/Sweden/V599/2... 38.2 0.17
gb|EU748905.1| Influenza A virus (A/falcon/Saudi Arabia/D1795... 38.2 0.17
gb|EU717858.1| Influenza A virus (A/chicken/Egypt/1709-6/2008... 38.2 0.17
gb|EU717856.1| Influenza A virus (A/chicken/Egypt/1709-5/2008... 38.2 0.17
gb|EU717854.1| Influenza A virus (A/chicken/Egypt/1709-4VIR08... 38.2 0.17
gb|EU717852.1| Influenza A virus (A/duck/Egypt/1709-3VIR08/20... 38.2 0.17
gb|EU717850.1| Influenza A virus (A/chicken/Egypt/1709-1VIR08... 38.2 0.17
gb|EU697218.1| Influenza A virus (A/chicken/Nigeria/228-5/200... 38.2 0.17
gb|EU697225.1| Influenza A virus (A/chicken/Nigeria/228-6/200... 38.2 0.17
gb|EU697233.1| Influenza A virus (A/chicken/Nigeria/228-10/20... 38.2 0.17
gb|EU574921.1| Influenza A virus (A/chicken/Israel/1055/2008(... 38.2 0.17
gb|EU443567.1| Influenza A virus (A/Cygnus olor/Czech Republi... 38.2 0.17
gb|EU443566.1| Influenza A virus (A/Mergus albellus/Slovakia/... 38.2 0.17
gb|EU443565.1| Influenza A virus (A/Peregrine falcon/Slovakia... 38.2 0.17
gb|EU443564.1| Influenza A virus (A/Cygnus olor/Czech Republi... 38.2 0.17
emb|AM498620.1| Influenza A virus (A/mute swan/France/06254a/... 38.2 0.17
emb|AM498619.1| Influenza A virus (A/mute swan/France/06303/2... 38.2 0.17
emb|AM498617.1| Influenza A virus (A/common pochard/France/06... 38.2 0.17
gb|EU146881.1| Influenza A virus (A/chicken/Egypt/3/2006(H5N1... 38.2 0.17
gb|EU146882.1| Influenza A virus (A/Egypt/902782/2006(H5N1)) ... 38.2 0.17
gb|EU146883.1| Influenza A virus (A/Egypt/902786/2006(H5N1)) ... 38.2 0.17
gb|EU146891.1| Influenza A virus (A/chicken/Egypt/1/2006(H5N1... 38.2 0.17
gb|EU146892.1| Influenza A virus (A/chicken/Egypt/2/2006(H5N1... 38.2 0.17
gb|EF619973.1| Influenza A virus (A/turkey/Turkey/1/2005(H5N1... 38.2 0.17
emb|AM262563.1| Influenza A virus (A/chicken/Nigeria/SO494/20... 38.2 0.17
emb|AM262562.1| Influenza A virus (A/chicken/Nigeria/SO493/20... 38.2 0.17
emb|AM262561.1| Influenza A virus (A/chicken/Nigeria/SO452/20... 38.2 0.17
emb|AM262560.1| Influenza A virus (A/chicken/Nigeria/SO300/20... 38.2 0.17
gb|EF532643.1| Influenza A virus (A/duck/Gaza/760/2006(H5N1))... 38.2 0.17
gb|EF532642.1| Influenza A virus (A/chicken/Gaza/714/2006(H5N... 38.2 0.17
gb|EF532641.1| Influenza A virus (A/chicken/Gaza/713/2006(H5N... 38.2 0.17
gb|EF532640.1| Influenza A virus (A/chicken/Israel/625/2006(H... 38.2 0.17
gb|EF532639.1| Influenza A virus (A/chicken/Gaza/450/2006(H5N... 38.2 0.17
gb|EF532638.1| Influenza A virus (A/turkey/Israel/446/2006(H5... 38.2 0.17
gb|EF532637.1| Influenza A virus (A/chicken/Israel/397/2006(H... 38.2 0.17
gb|EF532636.1| Influenza A virus (A/turkey/Israel/365/2006(H5... 38.2 0.17
gb|EF532635.1| Influenza A virus (A/turkey/Israel/364/2006(H5... 38.2 0.17
gb|EF532634.1| Influenza A virus (A/turkey/Israel/345/2006(H5... 38.2 0.17
gb|EF532633.1| Influenza A virus (A/duck/Gaza/834/2006(H5N1))... 38.2 0.17
gb|EF486250.1| Influenza A virus (A/goose/Egypt/13009N3-SM2/2... 38.2 0.17
gb|EF486249.1| Influenza A virus (A/duck/Egypt/1888N3-SM25/20... 38.2 0.17
gb|EF486248.1| Influenza A virus (A/duck/Egypt/13010N3-CLEVB/... 38.2 0.17
gb|EF486247.1| Influenza A virus (A/duck/Egypt/12380N3-CLEVB/... 38.2 0.17
gb|EF486246.1| Influenza A virus (A/chicken/Egypt/1892N3-HK49... 38.2 0.17
gb|EF486245.1| Influenza A virus (A/chicken/Egypt/1891N3-CLEV... 38.2 0.17
gb|EF486244.1| Influenza A virus (A/chicken/Egypt/1890N3-HK45... 38.2 0.17
gb|EF486243.1| Influenza A virus (A/chicken/Egypt/1889N3-SM26... 38.2 0.17
gb|EF486242.1| Influenza A virus (A/chicken/Egypt/12379N3-CLE... 38.2 0.17
gb|EF486241.1| Influenza A virus (A/chicken/Egypt/12378N3-CLE... 38.2 0.17
gb|EF486240.1| Influenza A virus (A/chicken/Egypt/1129N3-HK9/... 38.2 0.17
gb|EF447431.1| Influenza A virus (A/chicken/Russia_Moscow obl... 38.2 0.17
gb|CY020655.1| Influenza A virus (A/turkey/Egypt/2253-2/2006(... 38.2 0.17
gb|CY020647.1| Influenza A virus (A/chicken/Egypt/2253-1/2006... 38.2 0.17
gb|CY020351.1| Influenza A virus (A/cygnus olor/Italy/808/200... 38.2 0.17
gb|EF474448.1| Influenza A virus (A/chicken/Moscow/2/2007(H5N... 38.2 0.17
gb|EF222324.1| Influenza A virus (A/Egypt/12374-NAMRU3/2006(H... 38.2 0.17
gb|EF222323.1| Influenza A virus (A/Egypt/14724-NAMRU3/2006(H... 38.2 0.17
gb|EF165588.1| Influenza A virus (A/great crested grebe/Bavar... 38.2 0.17
gb|EF165578.1| Influenza A virus (A/mute swan/Bavaria/12/2006... 38.2 0.17
gb|CY017045.1| Influenza A virus (A/swan/Slovenia/760/2006(H5... 38.2 0.17
gb|CY016901.1| Influenza A virus (A/duck/Egypt/2253-3/2006(H5... 38.2 0.17
gb|DQ659680.1| Influenza A virus (A/common bussard/Bavaria/2/... 38.2 0.17
gb|DQ534021.1| Influenza A virus A/Cygnus olor/Czech Republic... 38.2 0.17
Reply With Quote
  #15  
Old April 6th, 2009, 08:31 AM
HenryN HenryN is offline
Retired
 
Join Date: Feb 2006
Posts: 20,294
Default Re: H5N1 Vietnam 2008 Clade 7

gb|FJ538949.1| Influenza A virus (A/chicken/Vietnam/NCVD-093/... 40.1 0.044
gb|FJ688369.1| Influenza A virus (A/chicken/Egypt/24NLQP-CLEV... 40.1 0.044
gb|FJ688367.1| Influenza A virus (A/chicken/Egypt/17NLQP-CLEV... 40.1 0.044
gb|FJ688365.1| Influenza A virus (A/chicken/Egypt/10NLQP-CLEV... 40.1 0.044
gb|FJ688364.1| Influenza A virus (A/chicken/Egypt/4NLQP-CLEVB... 40.1 0.044
gb|FJ461658.1| Influenza A virus (A/Egypt/3300-NAMRU3/2008(H5... 40.1 0.044
gb|EU717858.1| Influenza A virus (A/chicken/Egypt/1709-6/2008... 40.1 0.044
gb|EU717856.1| Influenza A virus (A/chicken/Egypt/1709-5/2008... 40.1 0.044
gb|EU574921.1| Influenza A virus (A/chicken/Israel/1055/2008(... 40.1 0.044
gb|EU430497.1| Influenza A virus (A/domestic green-winged tea... 40.1 0.044
gb|EU430510.1| Influenza A virus (A/domestic green-winged tea... 40.1 0.044
gb|EF587279.1| Influenza A virus (A/Beijing/01/2003(H5N1)) se... 40.1 0.044
gb|EF124329.1| Influenza A virus (A/goose/Yunnan/3644/2005(H5... 40.1 0.044
gb|EF124310.1| Influenza A virus (A/goose/Yunnan/3315/2005(H5... 40.1 0.044
gb|DQ997539.1| Influenza A virus (A/chicken/Jilin/xv/2002(H5N... 40.1 0.044
gb|DQ997378.1| Influenza A virus (A/chicken/Jilin/hf/2002(H5N... 40.1 0.044
gb|DQ997284.1| Influenza A virus (A/chicken/Jilin/hd/2002(H5N... 40.1 0.044
gb|AY653195.1| Influenza A virus (A/chicken/Jilin/9/2004(H5N1... 40.1 0.044
Reply With Quote
Reply


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is On

Disclaimer:

The reader is responsible for discerning the validity, factuality or implications of information posted here, be it fictional or based on real events. Moderators on this forum make every effort to review the material posted on this site however, it is not realistically possible for our staff to manually review each post.

The content of posts on this site, including but not limited to links to other web sites, are the expressed opinion of the original authors or posters and are not endorsed by, or representative of the opinions of, the owners or administration of this website. The posts on this website are the opinion of the specific author or poster and should not be construed as statements of advice or factual information.

Not all posts on this website are intended as truthful or factual assertion by their authors. NO posts on this website should be considered factual information on face value alone. Users are encouraged to USE DISCERNMENT and do their own follow up research while reading and posting on this website. FluTrackers.com Inc. reserves the right to make changes to, corrections and/or remove entirely at any time posts made on this website without notice. In addition, FluTrackers.com Inc. disclaims any and all liability for damages incurred directly or indirectly as a result of a post on this website.

This site is provided "as is" without warranty of any kind, either expressed or implied. You should not assume that this site is error-free or that it will be suitable for the particular purpose which you have in mind when using it. In no event shall FluTrackers.com Inc. be liable for any special, incidental, indirect or consequential damages of any kind, or any damages whatsoever, including, without limitation, those resulting from loss of use, data or profits, whether or not advised of the possibility of damage, and on any theory of liability, arising out of or in connection with the use or performance of this site or other documents which are referenced by or linked to this site.

Finally, FluTrackers.com Inc. reserves the right to delete, correct, or make changes to any post on this website without notice at any time for any reason.

Fair Use Notice:
This site may contain copyrighted material the use of which has not always been specifically authorized by the copyright owner. Users may make such material available in an effort to advance awareness and understanding of issues relating to public health, civil rights, economics, individual rights, international affairs, liberty, science & technology, etc. We believe this constitutes a 'fair use' of any such copyrighted material as provided for in section 107 of the US Copyright Law. In accordance with Title 17 U.S.C.Section 107, the material on this site is distributed to those who have expressed a prior interest in receiving the included information for research and educational purposes.

In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article. Please remember you are responsible for what you post on the internet and you could be sued by the original copyright holder if you do not honor these rules.

If you are a legal copyright holder or a designated agent for such and you believe a post on this website falls outside the boundaries of "Fair Use" and legitimately infringes on yours or your clients copyright

we may be contacted concerning copyright matters at:

FluTrackers.com Inc.
c/o Sharon Sanders
1676 Hibiscus Avenue
Winter Park, Florida 32789
Phone: 407-406-3037
E-Mail: flutrackers@earthlink.net

In accordance with section 512 of the U.S. Copyright Act our contact information has been registered with the United States Copyright Office. "Safe Harbor" noticing procedures as outlined in the DMCA apply to this website concerning all 3rd party posts published herein.

If notice is given of an alleged copyright violation we will act expeditiously to remove or disable access to the material(s) in question.

All 3rd party material posted on this website is the copyright of the respective owners / authors. FluTrackers.com Inc. makes no claim of copyright on such material.

For more information please visit: http://www.law.cornell.edu/uscode/17/107.shtml

Please be aware any communications sent complaining about a post on this website may be posted publicly at the discretion of the administration.

FluTrackers Does Not Provide Any Medical Advice:

FluTrackers, Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster.

The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website.

By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.

By using and/or accessing this site, either passively or actively, you are agreeing to all of the above conditions. Also, by using and/or accessing this site, either passively or actively, you agree to conduct all business and legal affairs related to this website in the jurisdiction of Flutrackers.com Inc. which is registered in Central Florida, USA.

These Disclaimers are subject to change at anytime.

Email the Webmaster with questions or comments about this site at flutrackers@earthlink.net


All times are GMT -4. The time now is 05:15 PM.