• FluTrackers.com Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster. The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website. By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
  • We are not asking for any donations. Do not donate to any entity who says they are raising funds for us.

Human antibodies reveal a protective epitope that is highly conserved among human and nonhuman influenza A viruses

tetano

Editor, Senior Moderator
Human antibodies reveal a protective epitope that is highly conserved among human and nonhuman influenza A viruses

1. Andres G. Grandea IIIa,1,
2. Ole A. Olsena,1,
3. Thomas C. Coxa,
4. Mark Renshawa,
5. Philip W. Hammonda,
6. Po-Ying Chan-Huia,
7. Jennifer L. Mitchama,
8. Witold Cieplaka,
9. Shaun M. Stewartb,
10. Michael L. Granthamb,
11. Andrew Pekoszb,
12. Maki Kisoc,
13. Kyoko Shinyad,
14. Masato Hattae,
15. Yoshihiro Kawaokac,d,e,f, and
16. Matthew Moylea,2

1.
aTheraclone Sciences, Seattle, WA, 98104;
2.
bThe W. Harry Feinstone Department of Molecular Microbiology and Immunology, The Johns Hopkins University, Bloomberg School of Public Health, Baltimore, MD, 21205;
3.
cDivision of Virology, Department of Microbiology and Immunology, and International Research Center for Infectious Diseases, Institute of Medical Science, University of Tokyo, Minato-ku 108-8639, Tokyo, Japan;
4.
dDepartment of Microbiology and Infectious Diseases, Kobe University, Hyogo 650-0017, Japan;
5.
eInfluenza Research Institute, Department of Pathological Sciences, University of Wisconsin-Madison, Madison, WI, 53792; and
6.
fExploratory Research for Advanced Technology Infection-Induced Host Responses Project, Japan Science and Technology Agency, Saitama 332-0012, Japan

1.

Edited* by Francis V. Chisari, The Scripps Research Institute, La Jolla, CA, and approved June 1, 2010 (received for review October 12, 2009)

Abstract

Influenza remains a serious public health threat throughout the world. Vaccines and antivirals are available that can provide protection from infection. However, new viral strains emerge continuously because of the plasticity of the influenza genome, which necessitates annual reformulation of vaccine antigens, and resistance to antivirals can appear rapidly and become entrenched in circulating virus populations. In addition, the spread of new pandemic strains is difficult to contain because of the time required to engineer and manufacture effective vaccines. Monoclonal antibodies that target highly conserved viral epitopes might offer an alternative protection paradigm. Herein we describe the isolation of a panel of monoclonal antibodies derived from the IgG+ memory B cells of healthy, human subjects that recognize a previously unknown conformational epitope within the ectodomain of the influenza matrix 2 protein, M2e. This antibody binding region is highly conserved in influenza A viruses, being present in nearly all strains detected to date, including highly pathogenic viruses that infect primarily birds and swine, and the current 2009 swine-origin H1N1 pandemic strain (S-OIV). Furthermore, these human anti-M2e monoclonal antibodies protect mice from lethal challenges with either H5N1 or H1N1 influenza viruses. These results suggest that viral M2e can elicit broadly cross-reactive and protective antibodies in humans. Accordingly, recombinant forms of these human antibodies may provide useful therapeutic agents to protect against infection from a broad spectrum of influenza A strains.


http://www.pnas.org/content/early/2010/06/29/0911806107.abstract
 
Re: Human antibodies reveal a protective epitope that is highly conserved among human and nonhuman influenza A viruses

.pdf: http://www.pnas.org/content/early/2010/06/29/0911806107.full.pdf

so, what is the epitope ?

97 positions in M2 ,
T11I,N13S,G14E,E16G,K18R,S20N

longest consecutive subsequence of human and bird identity from positions 58-76
that would be : GLKRGPSTEGVPESMREEY

>A/Index/1977(H1N1)
MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLKRGPSTEGVPESMREEYRKEQQNAVDADDSHFVNIELE}
>A/Brevig Mission/1/1918(H1N1)
MSLLTEVETPTRNEWGCRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSTEGVPESMREEYRKEQQSAVDVDDGHFVNIELE}
>A/******/index/2009/02/01
MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE}
>A/swine/Germany/2/1981(H1N1)=1578
MSLLTEVETPTRNGWGCRCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE}
>A/Index/birds/2000(H3N8a)
MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE}

Code:
                                 00000000000000000000000
                                 00000000000000000000000
                                 11111223344555556778889
                                 13468081638014576782693
                                 -----------------------
                                 TNGEKSISLLFCIRLYERQSVGN
>A/Index/1977(H1N1)              I.EGRNV......LFH..KNAS.
>A/Brevig Mission/1/1918(H1N1)   ..EGRN............K....
>A/******/index/2009/02/01(H1N1) .SE.R..N.T....F..Q.....
>A/Brisbane/10/2007/02/06(H3N2)  I.EGRNVN....VLFH..KNASS
>A/Kansas/UR06-0068/2007(H1N1)   I.E.RNV.VISS.IFH..ENADS
>A/New Caledonia/20/1999(H1N1)   I.EGRNV.VISS.IFH..ENA.S
>A/Brisbane/59/2007/07/01(H1N1)  I.EGRNV.VISS.IFH..ENADS
>A/Index-se9agbi.26(H5N1)        ..E.R.V................
>Index-se9agbi.51                ..E.R.V................
>A/Ck/Henan/16/04(H5N1)          ..E.R.V.........A......
>Index Qinghai                   ..E.R.V............N...
>A/swine/Germany/2/1981(H1N1)    ...GR..................
>A/Index/birds/2000(H3N8a)       .......................

-------edit-------------
SLLTEVETPTRNGWECKCSDSSD
from figure 2 woud be positions 2-24
 
Back
Top Bottom