Announcement

Collapse
No announcement yet.

Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

Collapse
X
 
  • Filter
  • Time
  • Show
Clear All
new posts

  • Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

    Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

    By Jason Gale
    April 2 (Bloomberg) -- A bird flu virus killed dogs in South Korea, showing that a pure avian strain of influenza is capable of crossing a species barrier and causing outbreaks of severe disease in mammals, a new study found.

    A cocker spaniel and a miniature schnauzer were among dozens of dogs in South Korea sickened by an H3N2 strain from birds, researchers said in a study published in the May issue of Emerging Infectious Diseases journal. Viruses taken from the sick canines were used in an experiment later to see if pathogens were capable of spreading from dog to dog.

    The findings add to scientific understanding of how flu viruses evolve in animals and the risks they pose to humans. Previous studies showed that the H5N1 bird flu strain, a type-A influenza that's killed at least 236 people worldwide, can infect dogs, cats and other mammals. The H5N1 virus, which isn't known to transmit efficiently in non-bird species, would become more dangerous to people if it achieved that feat.

    ``Transmission of avian influenza A virus to a new mammalian species is of great concern because it potentially allows the virus to adapt to a new mammalian host, cross new species barriers, and acquire pandemic potential,'' the Korean researchers said.

    The study, led by Daesub Song, Bokyu Kang and Chulseung Lee of the Green Cross Veterinary Products Co. and Daewoong Pharmaceutical Co. at Yong-in, outside Seoul, followed cases of severe respiratory disease last year in dogs at three veterinary clinics in Kyunggi province.
    Tests on specimens collected from three of the dogs showed they were infected with H3N2 viruses closely resembling those found in chickens and doves in South Korea in 2003. The pathogens may have been transmitted from birds to dogs fed raw, minced meat from infected ducks and chickens, the authors said.

    Dog Farms

    ``In South Korea, untreated duck and chicken meats, including internal organs and heads, have been widely used to feed dogs for fattening in local canine farms or kennels,'' they said.

    Dog is regarded by some Koreans as a delicacy. Seoul city officials will ask the national government to include the animal in the legal definition of livestock, the Chosun Ilbo newspaper reported last week.

    A variant of the H3N2 virus causes seasonal flu in humans. A canine strain was linked to an outbreak among 13 dogs at an animal hospital and later reported at a kennel in Jeolla province, where as many as 52 canines were infected, most likely as the virus spread from dog to dog, the Korean researchers said.

    Seal, Dogs

    Avian flu viruses are known to transmit to unrelated mammalian species only rarely, the researchers said. Bird- derived H7 and H4 flu viruses were reported in seals in the early 1980s, and the H5N1 bird-flu strain was found in a dog that fed on a duck infected with the virus in Thailand in 2004, according to the study.

    Large cats, including tigers and leopards, kept in capacity and fed on infected poultry carcasses, have also been infected and developed severe disease.

    ``This is an important and interesting study because previous avian-to-mammal influenza infection by H5 or H7 were not efficient in subsequent human-to-human or cat-to-cat transmission, whereas this study shows an outbreak of 13 dogs in addition to sporadic cases,'' said Yuen Kwok-yung, a microbiology professor at the University of Hong Kong.

    ``Efficient mammal-to-mammal transmission'' of H3N2 viruses isn't unexpected since variations of the strain regularly infect humans and pigs, Yuen said in an interview today.

    Dogs may be more susceptible to flu strains carried by birds because both canines and birds share a specific type of virus-binding site in their respiratory systems which is less common in humans.

    The bird-like H3N2 virus may be capable of spreading between dogs because it was excreted in nasal discharges of experimentally infected Beagle puppies, the study found.

    Evidence of avian flu in pet dogs ``raises the concern that dogs may be become a new source of transmission of novel influenza viruses, especially where avian influenza viruses are circulating or have been detected,'' the authors said.

    To contact the reporter on this story: Jason Gale in Singapore at j.gale@bloomberg.net
    Last Updated: April 2, 2008 03:44 EDT



  • #2
    Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

    (1b) [RESEARCH, ABSTRACTS, AVIAN INFLUENZA, A/H3N2, DOGS] Transmission of Avian Influenza Virus (H3N2) to Dogs
    Daesub Song,*1 Bokyu Kang,*1 Chulseung Lee,* Kwonil Jung,? Gunwoo Ha,? Dongseok Kang,? Seongjun Park,? Bongkyun Park,? and Jinsik Oh?
    *Green Cross Veterinary Products Company, Ltd., Yong-in, South Korea; ?Daewoong Pharmaceutical Company, Ltd., Yong-in, South Korea; ?Animal Genetics, Inc., Suwon, South Korea; and ?Seoul National University, Seoul, South Korea
    1These authors contributed equally to this article.

    In South Korea, where avian influenza virus subtypes H3N2, H5N1, H6N1, and H9N2 circulate or have been detected, 3 genetically similar canine influenza virus (H3N2) strains of avian origin (A/canine/Korea/01/07, A/canine/Korea/02/07, and A/canine/Korea/03/07) were isolated from dogs exhibiting severe respiratory disease.
    To determine whether the novel canine influenza virus of avian origin was transmitted among dogs, we experimentally infected beagles with this influenza virus (H3N2) isolate.
    The beagles shed virus through nasal excretion, seroconverted, and became ill with severe necrotizing tracheobronchitis and bronchioalveolitis with accompanying clinical signs (e.g., high fever).
    Consistent with histologic observation of lung lesions, large amounts of avian influenza virus binding receptor (SAα 2,3-gal) were identified in canine tracheal, bronchial, and bronchiolar epithelial cells, which suggests potential for direct transmission of avian influenza virus (H3N2) from poultry to dogs.
    Our data provide evidence that dogs may play a role in interspecies transmission and spread of influenza virus.
    -

    -----

    Comment


    • #3
      Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

      (1.6): J Gen Virol. 2008 Apr;89(Pt 4):949-57.
      Ecology of H3 avian influenza viruses in Korea and assessment of their pathogenic potentials.

      Song MS, Oh TK, Moon HJ, Yoo DW, Lee EH, Lee JS, Kim CJ, Yoo GJ, Kim H, Choi YK.
      College of Medicine and Medical Research Institute, Chungbuk National University, 12 Gaeshin-Dong Heungduk-Ku, Cheongju 361-763, Republic of Korea.

      To determine the genetic origins of novel H3 avian influenza viruses of chickens and ducks in Korea, genetic characterization of H3 avian influenza viruses isolated from live poultry markets and migratory aquatic birds in South Korea during 2004-2006 was conducted.
      Phylogenetic analysis revealed that at least four novel genotypes of H3N2 and two genotypes of H3N6 avian influenza viruses were co-circulating in backyard poultry of Korea.
      The viruses were reassortants between H9N2 viruses of Korean chickens and unknown influenza viruses of migratory birds.
      Genetic comparison of H3 viruses from live bird markets with those from wild bird isolates revealed that certain gene segments of wild bird isolates are related closely to those of Korean group H9N2 viruses isolated from live poultry markets in 2003.
      Furthermore, animal-challenge studies demonstrated that the pathogenicity of certain avian H3 influenza viruses was altered due to reassortment, leading to H3 avian influenza viruses in Korea that can potentially expand their host range to include mammals.
      These studies emphasize the continuing need to monitor backyard poultry at live poultry markets to better understand interspecies transmission and the emergence of novel influenza viruses that have the potential to infect humans.
      PMID: 18343836 [PubMed - in process]
      -
      ------

      Comment


      • #4
        Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

        <TABLE cellPadding=0 width="100%"><TBODY><TR><TD style="WHITE-SPACE: nowrap" vAlign=top width="20%"><INPUT id=UidCheckBox type=checkbox value=156968371 name=EntrezSystem2.PEntrez.Nuccore.Sequence_Result sPanel.Sequence_RVDocSum.uid sid="1">1: EU127501</TD><TD vAlign=top align=left>
        Reports<SCRIPT language=JavaScript1.2><!--var PopUpMenu2_LocalConfig_Reports156968371 = [ ["TitleText","Reports"]];var Reports156968371 = [ ["UseLocalConfig","Reports156968371","",""], ["ASN.1","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=as n'","",""], ["XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=xm l'","",""], ["Summary","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=do csum'","",""], ["Brief","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=br ief'","",""], ["FASTA","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=fa sta'","",""], ["TinySeq XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=fa sta_xml'","",""], ["GenBank","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=gb '","",""], ["INSDSeq XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=gb c_xml'","",""], ["GenBank(Full)","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=gb withparts'","",""], ["GI List","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=gi '","",""], ["Graphic","window.top.location='?cmd=Show&dopt=gra ph&db=nuccore&term=EU127501'","",""], ["Revision History","window.top.location='/entrez/sutils/girevhist.cgi?val=EU127501'","",""]]--></SCRIPT> </TD><TD vAlign=top align=right>
        </TD></TR><TR><TD style="PADDING-LEFT: 2.8em" vAlign=top align=left colSpan=3>
        gi|156968371|gb|EU127501|[156968371]
        This record is not yet available.

        <TABLE cellPadding=0 width="100%"><TBODY><TR><TD style="WHITE-SPACE: nowrap" vAlign=top width="20%"><INPUT id=UidCheckBox type=checkbox value=156968369 name=EntrezSystem2.PEntrez.Nuccore.Sequence_Result sPanel.Sequence_RVDocSum.uid sid="1">1: EU127500</TD><TD vAlign=top align=left>
        Reports<SCRIPT language=JavaScript1.2><!--var PopUpMenu2_LocalConfig_Reports156968369 = [ ["TitleText","Reports"]];var Reports156968369 = [ ["UseLocalConfig","Reports156968369","",""], ["ASN.1","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=as n'","",""], ["XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=xm l'","",""], ["Summary","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=do csum'","",""], ["Brief","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=br ief'","",""], ["FASTA","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=fa sta'","",""], ["TinySeq XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=fa sta_xml'","",""], ["GenBank","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=gb '","",""], ["INSDSeq XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=gb c_xml'","",""], ["GenBank(Full)","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=gb withparts'","",""], ["GI List","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=gi '","",""], ["Graphic","window.top.location='?cmd=Show&dopt=gra ph&db=nuccore&term=EU127500'","",""], ["Revision History","window.top.location='/entrez/sutils/girevhist.cgi?val=EU127500'","",""]]--></SCRIPT> </TD><TD vAlign=top align=right>
        </TD></TR><TR><TD style="PADDING-LEFT: 2.8em" vAlign=top align=left colSpan=3>
        gi|156968369|gb|EU127500|[156968369]
        This record is not yet available.</TD></TR></TBODY></TABLE>
        </TD></TR></TBODY></TABLE><SCRIPT language=JavaScript1.2><!-- var PopUpMenu2_LocalConfig_jsmenu3Config = [ ["ShowCloseIcon","yes"], ["Help","window.open('/entrez/query/static/popup.html','Links_Help','resizable=no, scrollbars=yes, toolbar=no, location=no, directories=no, status=no, menubar=no, copyhistory=no, alwaysRaised=no, depend=no, width=400, height=500');"], ["TitleText"," Links "] ] var jsmenu3Config = [ ["UseLocalConfig","jsmenu3Config","",""] ] function ShowLinks(url,linkscount) { var X,Y; var H = (linkscount + 5)*30, W = 300; if(parseFloat(navigator.appVersion)>= 4) { if(navigator.appName=="Netscape") { X=window.innerWidth;Y=window.innerHeight; if(H > window.innerHeight) { H=window.innerHeight-50;} }else{ X=document.body.offsetWidth;Y=document.body.offset Height; if(H > document.body.offsetHeight) { H=window.innerHeight-50;} } Y=(screen.height)/2-H/2; X=(screen.width)/2-W/2; } window.open(url, 'Links','alwaysRaised=yes,screenX='+String(X)+',sc reenY='+String(Y)+',resizable=no,scrollbars=yes,to olbar=no,location=no,directories=no,status=no,menu bar=no,title=no,copyhistory=yes,width='+String(W)+ ',height='+String(H)).focus(); } --></SCRIPT><!-- - - - - - - - - end Results - - - - - - -->

        Comment


        • #5
          Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

          Korean H3N2 sequences get around

          Comment


          • #6
            Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

            Commentary

            Comment


            • #7
              Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

              Thank you Dr. Niman.

              <big><big>Commentary </big></big>

              Fatal H3N2 Infections in Companion Dogs in Korea

              Recombinomics Commentary 13:38
              April 2, 2008

              In South Korea, where avian influenza virus subtypes H3N2, H5N1, H6N1, and H9N2 circulate or have been detected, 3 genetically similar canine influenza virus (H3N2) strains of avian origin (A/canine/Korea/01/07, A/canine/Korea/02/07, and A/canine/Korea/03/07) were isolated from dogs exhibiting severe respiratory disease.

              Consistent with histologic observation of lung lesions, large amounts of avian influenza virus binding receptor (SAα 2,3-gal) were identified in canine tracheal, bronchial, and bronchiolar epithelial cells, which suggests potential for direct transmission of avian influenza virus (H3N2) from poultry to dogs.

              Our data provide evidence that dogs may play a role in interspecies transmission and spread of influenza virus.


              The above description from an abstract in an upcoming paper describes the detection of avian H3N2 in fatal infections in domestic dogs in South Korea. Although the H3N2 is most closely related to avian isolates, related sequences include H5N1. Prior reports of canine influenza in the United States detail H3N8 infections, involving sequences closely related to equine influenza.

              Both H3N8 and H3N2 are readily transmitted dog to dog and the multiple serotypes isolates from dogs (H3N2, H3N8, H5N1) raise concerns of accelerated influenza evolution involving the acquisition of mammalian polymorphisms.

              The phylogenetic tree in the paper indicated that the 2007 H3N2 isolates in dogs, were most closely related to human H3N2 from the early 1970?s, raising concerns that dogs could serve as reservoirs for earlier human polymorphisms.

              These findings raise significant concerns regarding the lack of influenza surveillance in multiple species, including domestic dogs and cats.

              Media Links
              "In the beginning of change, the patriot is a scarce man (or woman https://flutrackers.com/forum/core/i...ilies/wink.png), and brave, and hated and scorned. When his cause succeeds, the timid join him, for it then costs nothing to be a patriot."- Mark TwainReason obeys itself; and ignorance submits to whatever is dictated to it. -Thomas Paine

              Comment


              • #8
                Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

                Bird Flu Virus Crosses Species Barrier to Kill Dogs (Update1)

                By Jason Gale
                April 2 (Bloomberg) -- A bird flu virus killed dogs in South Korea, showing that a pure avian strain of influenza is capable of crossing a species barrier and causing outbreaks of severe disease in mammals, a new study found.
                A cocker spaniel and a miniature schnauzer were among dozens of dogs in South Korea sickened by an H3N2 strain from birds, researchers said in a study published in the May issue of Emerging Infectious Diseases journal. Viruses taken from the sick canines were used in an experiment later to see if pathogens were capable of spreading from dog to dog.
                The findings add to scientific understanding of how flu viruses evolve in animals and the risks they pose to humans. A separate bird flu strain called H5N1 has killed 236 people worldwide by spreading primarily from birds to humans. If a deadly H5N1 strain evolved like the strain in today's study to spread from one human to another, it could kill millions.
                ``Transmission of avian influenza A virus to a new mammalian species is of great concern because it potentially allows the virus to adapt to a new mammalian host, cross new species barriers, and acquire pandemic potential,'' the Korean researchers said.
                The study, led by Daesub Song, Bokyu Kang and Chulseung Lee of the Green Cross Veterinary Products Co. and Daewoong Pharmaceutical Co. at Yong-in, outside Seoul, followed cases of severe respiratory disease last year in dogs at three veterinary clinics in Kyunggi province.
                Close Resemblance
                Tests on specimens collected from three of the dogs showed they were infected with H3N2 viruses closely resembling those found in chickens and doves in South Korea in 2003. The pathogens may have been transmitted from birds to dogs fed raw, minced meat from infected ducks and chickens, the authors said.
                ``In South Korea, untreated duck and chicken meats, including internal organs and heads, have been widely used to feed dogs for fattening in local canine farms or kennels,'' they said.
                Dog is regarded by some Koreans as a delicacy. Seoul city officials will ask the national government to include the animal in the legal definition of livestock, the Chosun Ilbo newspaper reported last week.
                A variant of the H3N2 virus causes seasonal flu in humans. A canine strain was linked to an outbreak among 13 dogs at an animal hospital and later reported at a kennel in Jeolla province, where as many as 52 canines were infected, most likely as the virus spread from dog to dog, the Korean researchers said.
                Seal, Dogs
                Avian flu viruses are known to transmit to unrelated mammalian species only rarely, the researchers said. Bird- derived H7 and H4 flu viruses were reported in seals in the early 1980s, and the H5N1 bird-flu strain was found in a dog that fed on a duck infected with the virus in Thailand in 2004, according to the study.
                Large cats, including tigers and leopards, kept in capacity and fed on infected poultry carcasses, have also been infected and developed severe disease. Almost two of every three human H5N1 cases were fatal, according to the World Health Organization.
                ``This is an important and interesting study because previous avian-to-mammal influenza infection by H5 or H7 were not efficient in subsequent human-to-human or cat-to-cat transmission, whereas this study shows an outbreak of 13 dogs in addition to sporadic cases,'' said Yuen Kwok-yung, a microbiology professor at the University of Hong Kong.
                Not Unexpected
                ``Efficient mammal-to-mammal transmission'' of H3N2 viruses isn't unexpected since variations of the strain regularly infect humans and pigs, Yuen said in an interview today.
                Dogs may be more susceptible to flu strains carried by birds because both canines and birds share a specific type of virus-binding site in their respiratory systems which is less common in humans.
                The bird-like H3N2 virus may be capable of spreading between dogs because it was excreted in nasal discharges of experimentally infected Beagle puppies, the study found.
                Evidence of avian flu in pet dogs ``raises the concern that dogs may be become a new source of transmission of novel influenza viruses, especially where avian influenza viruses are circulating or have been detected,'' the authors said.
                To contact the reporter on this story: Jason Gale in Singapore at j.gale@bloomberg.net
                Last Updated: April 2, 2008 11:07 EDT

                Comment


                • #9
                  Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

                  Dogs may be more susceptible to flu strains carried by birds because both canines and birds share a specific type of virus-binding site in their respiratory systems which is less common in humans.

                  Really??

                  I'm sure the authors can trot out a perfectly logical explanation why canines, in the thousands of years of cohabitation with humans and their domesticated animals, have NEVER been reported to contract influenza - until the late 1990s - and it was an equine-adapted, not swine, not human and not avian, influenza strain.

                  Did the canines who contracted H3N8 (1997, possibly US greyhounds) and H5N1 (1997, Italy) got it from eating infected horse meat? Maybe...maybe not.

                  Canine Influenza Was Around Earlier Than Once Thought (ScienceDaily)
                  The canine influenza virus, first identified in 2004, had been circulating in the greyhound population for at least five years prior to its discovery and may have been responsible for numerous outbreaks of respiratory disease among dogs at racing tracks during that period, according to new research.


                  Well whadday know.



                  So we got a US strain that is circulating around race tracks in 1997, in Kentucky.

                  Genetic relatedness of recent Canadian equine influenza virus isolates with vaccine strains used in the field. Can Vet J. 2007 October; 48(10): 1028–1030.

                  Comment


                  • #10
                    Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

                    Orthomyxo-, paramyxo- and flavivirus infections in wild waterfowl in Finland.

                    <!--AuthorList-->Lindh E, Huovilainen A, Ratti O, Ek-Kommonen C, Sironen T, Huhtamo E, Poysa H, Vaheri A, Vapalahti O.
                    ABSTRACT: BACKGROUND: Screening wild birds for viral pathogens has become increasingly important. We tested a screening approach based on blood and cloacal and tracheal swabs collected by hunters to study the prevalence of influenza A, paramyxo-, flavi-, and alphaviruses in Finnish wild waterfowl, which has been previously unknown. We studied 310 blood samples and 115 mixed tracheal and cloacal swabs collected from hunted waterfowl in 2006. Samples were screened by RT-PCR and serologically by hemagglutination inhibition (HI) test or enzyme-linked immunosorbent assay (ELISA) for influenza A (FLUAV), type 1 avian paramyxo- (APMV-1), Sindbis (SINV), West Nile (WNV) and tick-borne encephalitis (TBEV) virus infections. RESULTS: FLUAV RNA was found in 13 tracheal/cloacal swabs and seven strains were isolated. Five blood samples were antibody positive. Six APMV-1 RNA-positive samples were found from which four strains were isolated, while two blood samples were antibody positive. None of the birds were positive for flavivirus RNA but three birds had flavivirus antibodies by HI test. No antibodies to SINV were detected. CONCLUSION: We conclude that circulation of both influenza A virus and avian paramyxovirus-1 in Finnish wild waterfowl was documented. The FLUAV and APMV-1 prevalences in wild waterfowl were 11.3% and 5.2% respectively, by this study. The subtype H3N8 was the only detected FLUAV subtype while APMV-1 strains clustered into two distinct lineages. Notably, antibodies to a likely mosquito-borne flavivirus were detected in three samples. The screening approach based on hunted waterfowl seemed reliable for monitoring FLUAV and APMV by RT-PCR from cloacal or tracheal samples, but antibody testing in this format seemed to be of low sensitivity.

                    PubMed® comprises more than 40 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full text content from PubMed Central and publisher web sites.

                    Comment


                    • #11
                      Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

                      Originally posted by niman View Post
                      <TABLE cellPadding=0 width="100%"><TBODY><TR><TD style="WHITE-SPACE: nowrap" vAlign=top width="20%"><INPUT id=UidCheckBox type=checkbox value=156968371 name=EntrezSystem2.PEntrez.Nuccore.Sequence_Result sPanel.Sequence_RVDocSum.uid sid="1">1: EU127501</TD><TD vAlign=top align=left>
                      Reports<SCRIPT language=JavaScript1.2><!--var PopUpMenu2_LocalConfig_Reports156968371 = [ ["TitleText","Reports"]];var Reports156968371 = [ ["UseLocalConfig","Reports156968371","",""], ["ASN.1","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=as n'","",""], ["XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=xm l'","",""], ["Summary","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=do csum'","",""], ["Brief","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=br ief'","",""], ["FASTA","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=fa sta'","",""], ["TinySeq XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=fa sta_xml'","",""], ["GenBank","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=gb '","",""], ["INSDSeq XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=gb c_xml'","",""], ["GenBank(Full)","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=gb withparts'","",""], ["GI List","window.top.location='/entrez/viewer.fcgi?list_uids=156968371&db=nuccore&dopt=gi '","",""], ["Graphic","window.top.location='?cmd=Show&dopt=gra ph&db=nuccore&term=EU127501'","",""], ["Revision History","window.top.location='/entrez/sutils/girevhist.cgi?val=EU127501'","",""]]--></SCRIPT>
                      </TD><TD vAlign=top align=right>

                      </TD></TR><TR><TD style="PADDING-LEFT: 2.8em" vAlign=top align=left colSpan=3>
                      gi|156968371|gb|EU127501|[156968371]
                      This record is not yet available.

                      <TABLE cellPadding=0 width="100%"><TBODY><TR><TD style="WHITE-SPACE: nowrap" vAlign=top width="20%"><INPUT id=UidCheckBox type=checkbox value=156968369 name=EntrezSystem2.PEntrez.Nuccore.Sequence_Result sPanel.Sequence_RVDocSum.uid sid="1">1: EU127500</TD><TD vAlign=top align=left>
                      Reports<SCRIPT language=JavaScript1.2><!--var PopUpMenu2_LocalConfig_Reports156968369 = [ ["TitleText","Reports"]];var Reports156968369 = [ ["UseLocalConfig","Reports156968369","",""], ["ASN.1","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=as n'","",""], ["XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=xm l'","",""], ["Summary","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=do csum'","",""], ["Brief","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=br ief'","",""], ["FASTA","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=fa sta'","",""], ["TinySeq XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=fa sta_xml'","",""], ["GenBank","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=gb '","",""], ["INSDSeq XML","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=gb c_xml'","",""], ["GenBank(Full)","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=gb withparts'","",""], ["GI List","window.top.location='/entrez/viewer.fcgi?list_uids=156968369&db=nuccore&dopt=gi '","",""], ["Graphic","window.top.location='?cmd=Show&dopt=gra ph&db=nuccore&term=EU127500'","",""], ["Revision History","window.top.location='/entrez/sutils/girevhist.cgi?val=EU127500'","",""]]--></SCRIPT>
                      </TD><TD vAlign=top align=right>

                      </TD></TR><TR><TD style="PADDING-LEFT: 2.8em" vAlign=top align=left colSpan=3>
                      gi|156968369|gb|EU127500|[156968369]
                      This record is not yet available.
                      </TD></TR></TBODY></TABLE>

                      </TD></TR></TBODY></TABLE><SCRIPT language=JavaScript1.2><!-- var PopUpMenu2_LocalConfig_jsmenu3Config = [ ["ShowCloseIcon","yes"], ["Help","window.open('/entrez/query/static/popup.html','Links_Help','resizable=no, scrollbars=yes, toolbar=no, location=no, directories=no, status=no, menubar=no, copyhistory=no, alwaysRaised=no, depend=no, width=400, height=500');"], ["TitleText"," Links "] ] var jsmenu3Config = [ ["UseLocalConfig","jsmenu3Config","",""] ] function ShowLinks(url,linkscount) { var X,Y; var H = (linkscount + 5)*30, W = 300; if(parseFloat(navigator.appVersion)>= 4) { if(navigator.appName=="Netscape") { X=window.innerWidth;Y=window.innerHeight; if(H > window.innerHeight) { H=window.innerHeight-50;} }else{ X=document.body.offsetWidth;Y=document.body.offset Height; if(H > document.body.offsetHeight) { H=window.innerHeight-50;} } Y=(screen.height)/2-H/2; X=(screen.width)/2-W/2; } window.open(url, 'Links','alwaysRaised=yes,screenX='+String(X)+',sc reenY='+String(Y)+',resizable=no,scrollbars=yes,to olbar=no,location=no,directories=no,status=no,menu bar=no,title=no,copyhistory=yes,width='+String(W)+ ',height='+String(H)).focus(); } --></SCRIPT><!-- - - - - - - - - end Results - - - - - - -->
                      LOCUS EU127500 722 bp cRNA linear VRL 02-APR-2008
                      DEFINITION Influenza A virus (A/canine/Korea/GCVP01/2007(H3N2)) hemagglutinin
                      (HA) gene, partial cds.
                      ACCESSION EU127500
                      VERSION EU127500.1 GI:156968369
                      KEYWORDS .
                      SOURCE Influenza A virus (A/canine/Korea/GCVP01/2007(H3N2))
                      ORGANISM Influenza A virus (A/canine/Korea/GCVP01/2007(H3N2))
                      Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
                      Influenzavirus A.
                      REFERENCE 1 (bases 1 to 722)
                      AUTHORS Song,D., Kang,B., Lee,C., Jung,K., Ha,G., Kang,D., Park,S.,
                      Park,B.K. and Oh,J.
                      TITLE Transmission of Avian Influenza Virus (H3N2) to Dogs
                      JOURNAL Emerging Infect. Dis. (2008) In press
                      REFERENCE 2 (bases 1 to 722)
                      AUTHORS Oh,J.S., Kang,B.K., Lee,C.S., Ha,G.W., Oh,Y.K., Jung,K.I.,
                      Park,S.J., Park,B.K. and Song,D.S.
                      TITLE Direct Submission
                      JOURNAL Submitted (30-AUG-2007) Department of Veterinary Medicine Virology
                      Lab, College of Veterinary Medicine, Seoul National University,
                      Sillim 9-dong, Gwanak-gu, Seoul 151-742, Korea
                      FEATURES Location/Qualifiers
                      source 1..722
                      /organism="Influenza A virus
                      (A/canine/Korea/GCVP01/2007(H3N2))"
                      /virion
                      /mol_type="viral cRNA"
                      /strain="A/Canine/Korea/GCVP01/2007"
                      /serotype="H3N2"
                      /db_xref="taxon:466141"
                      /country="South Korea"
                      gene <1..>722
                      /gene="HA"
                      CDS <1..>722
                      /gene="HA"
                      /codon_start=1
                      /product="hemagglutinin"
                      /protein_id="ABU98641.1"
                      /db_xref="GI:156968370"
                      /translation="QIEVTNATELVQNSSTGKICNNPHKILDGRDCTLIDA LLGDPHC
                      DVFQNETWDLFVERSNAFSNCYPYDVPDYASLRSIVASSGTLEFITEGFT WAGVTQNR
                      GSGACKRGPANGFFSRLNWLTKSGNTYPVLNVTMPNNNNFDKLYIWGVHH PSTNQEQT
                      SLYIQASGRVTVSTRRSQQTIIPNIGSRPLVRGQSGRISVYWTIVKPGDV LVINSNGN
                      LIAPRGYFKMRIGKSSIMRSDAP"
                      ORIGIN
                      1 cagattgagg tgaccaatgc cactgagcta gtccaaaact cctcaacagg gaaaatatgc
                      61 aacaatcccc acaagattct tgatgggagg gactgcacac taatagatgc cctactaggg
                      121 gacccgcact gtgatgtctt ccaaaatgag acatgggacc tttttgtgga acgaagcaat
                      181 gcttttagca attgttaccc ttatgatgta ccagactatg catcccttcg atccatagtt
                      241 gcatcatcag gcacattgga gttcatcact gaaggtttca cttgggcagg agtaactcaa
                      301 aatagaggaa gcggtgcttg caaaagggga cctgctaatg gtttcttcag tagattgaat
                      361 tggttaacta agtcaggaaa tacatatcca gtgttgaatg tgactatgcc aaacaataac
                      421 aatttcgaca aattatacat ttggggagtt catcacccaa gcactaatca agaacaaacc
                      481 agcctgtata ttcaggcctc aggaagagtc acagtctcta ccaggagaag ccaacagacc
                      541 ataatcccaa acattggatc tagacccttg gtaaggggcc aatctggcag aataagcgta
                      601 tattggacaa tagtcaaacc tggagacgta ctggtaataa acagtaatgg aaacctaatc
                      661 gctcctcgag gctacttcaa aatgcgcatt gggaaaagct caataatgag atcagatgca
                      721 cc

                      Comment


                      • #12
                        Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

                        LOCUS EU127501 457 bp cRNA linear VRL 02-APR-2008
                        DEFINITION Influenza A virus (A/canine/Korea/GCVP01/2007(H3N2)) neuraminidase
                        (NA) gene, partial cds.
                        ACCESSION EU127501
                        VERSION EU127501.1 GI:156968371
                        KEYWORDS .
                        SOURCE Influenza A virus (A/canine/Korea/GCVP01/2007(H3N2))
                        ORGANISM Influenza A virus (A/canine/Korea/GCVP01/2007(H3N2))
                        Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
                        Influenzavirus A.
                        REFERENCE 1 (bases 1 to 457)
                        AUTHORS Song,D., Kang,B., Lee,C., Jung,K., Ha,G., Kang,D., Park,S.,
                        Park,B.K. and Oh,J.
                        TITLE Transmission of Avian Influenza Virus (H3N2) to Dogs
                        JOURNAL Emerging Infect. Dis. (2008) In press
                        REFERENCE 2 (bases 1 to 457)
                        AUTHORS Oh,J.S., Kang,B.K., Lee,C.S., Ha,G.W., Oh,Y.K., Jung,K.I.,
                        Park,S.J., Park,B.K. and Song,D.S.
                        TITLE Direct Submission
                        JOURNAL Submitted (30-AUG-2007) Department of Veterinary Medicine Virology
                        Lab, College of Veterinary Medicine, Seoul National University,
                        Sillim 9-dong, Gwanak-gu, Seoul 151-742, Korea
                        FEATURES Location/Qualifiers
                        source 1..457
                        /organism="Influenza A virus
                        (A/canine/Korea/GCVP01/2007(H3N2))"
                        /virion
                        /mol_type="viral cRNA"
                        /strain="A/Canine/Korea/GCVP01/2007"
                        /serotype="H3N2"
                        /db_xref="taxon:466141"
                        /country="South Korea"
                        gene <1..>457
                        /gene="NA"
                        CDS <1..>457
                        /gene="NA"
                        /codon_start=2
                        /product="neuraminidase"
                        /protein_id="ABU98642.1"
                        /db_xref="GI:156968372"
                        /translation="HLGTKQVCIAWSSSSCHDGKAWLHVCVTGDDRNATAS FVYNGML
                        VDSIGSWSRNILRTQESECVCINGTCTVVMTDGSASGRADTRILFIREGK IVHISPLS
                        GSAQHIEECSCYPRYPNVRCVCRDNWKGSNRPVIDINMADYSIDSSYVCS "
                        ORIGIN
                        1 tcatttggga accaaacaag tgtgcatagc atggtccagt tcaagttgtc acgatgggaa
                        61 agcatggtta catgtttgtg tcactgggga tgatagaaat gcgactgcta gtttcgttta
                        121 taatggaatg cttgttgaca gtattggttc atggtctcga aatatcctca gaactcagga
                        181 gtcagaatgc gtttgcatta atggaacttg tacagtagta atgactgatg gaagtgcatc
                        241 aggaagggct gatactagaa tactattcat cagagagggg aaaattgtcc atattagccc
                        301 attgtcaggg agtgctcaac atatagagga atgttcctgt tatcctcgat atccaaatgt
                        361 tagatgtgtt tgcagagaca attggaaggg ctctaatagg cccgttatag atataaatat
                        421 ggcagattat agcatcgatt ccagttatgt gtgttca

                        Comment


                        • #13
                          Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

                          Top 100 matches

                          gb|EU301215.1| Influenza A virus (A/aquatic bird/Korea/JN-2/2... 1207 0.0
                          gb|AY862612.1| Influenza A virus (A/dove/Korea/S11/03(H3N2)) ... 1171 0.0
                          gb|AY862607.1| Influenza A virus (A/chicken/Korea/S6/03(H3N2)... 1168 0.0
                          gb|AY862609.1| Influenza A virus (A/duck/Korea/S8/03(H3N2)) h... 1162 0.0
                          gb|AY862608.1| Influenza A virus (A/duck/Korea/S7/03(H3N2)) h... 1162 0.0
                          gb|AY862610.1| Influenza A virus (A/duck/Korea/S9/03(H3N2)) h... 1159 0.0
                          gb|AY862611.1| Influenza A virus (A/duck/Korea/S10/03(H3N2)) ... 1153 0.0
                          gb|EU301240.1| Influenza A virus (A/duck/Korea/LPM92/2006(H3N... 1144 0.0
                          gb|EU301230.1| Influenza A virus (A/duck/Korea/LPM39/2005(H3N... 1144 0.0
                          gb|EU301229.1| Influenza A virus (A/duck/Korea/LPM38/2005(H3N... 1144 0.0
                          gb|EU301228.1| Influenza A virus (A/duck/Korea/LPM36/2005(H3N... 1144 0.0
                          gb|EU301236.1| Influenza A virus (A/chicken/Korea/LPM67/2006(... 1141 0.0
                          gb|EU301235.1| Influenza A virus (A/duck/Korea/LPM66/2006(H3N... 1141 0.0
                          gb|EU301233.1| Influenza A virus (A/duck/Korea/LPM56/2005(H3N... 1141 0.0
                          gb|EU301239.1| Influenza A virus (A/duck/Korea/LPM91/2006(H3N... 1135 0.0
                          gb|EU301234.1| Influenza A virus (A/chicken/Korea/LPM61/2005(... 1135 0.0
                          gb|EU301222.1| Influenza A virus (A/chicken/Korea/LPM03/2004(... 1135 0.0
                          gb|EU301238.1| Influenza A virus (A/chicken/Korea/LPM88/2006(... 1126 0.0
                          gb|EU301223.1| Influenza A virus (A/duck/Korea/LPM09/2004(H3N... 1126 0.0
                          gb|EU301221.1| Influenza A virus (A/duck/Korea/LPM01/2004(H3N... 1126 0.0
                          gb|EU301225.1| Influenza A virus (A/duck/Korea/LPM18/2004(H3N... 1122 0.0
                          gb|EU301224.1| Influenza A virus (A/chicken/Korea/LPM17/2004(... 1122 0.0
                          gb|EU301227.1| Influenza A virus (A/duck/Korea/LPM23/2005(H3N... 1108 0.0
                          gb|EU301237.1| Influenza A virus (A/duck/Korea/LPM86/2006(H3N... 1104 0.0
                          gb|EU301231.1| Influenza A virus (A/chicken/Korea/LPM43/2005(... 1104 0.0
                          gb|EU301226.1| Influenza A virus (A/duck/Korea/LPM22/2005(H3N... 1104 0.0
                          gb|EU301232.1| Influenza A virus (A/chicken/Korea/LPM44/2005(... 1099 0.0
                          emb|AJ427297.1|INA427297 Influenza A virus (A/aquatic bird/Ho... 1023 0.0
                          gb|EU301212.1| Influenza A virus (A/aquatic bird/Korea/CN-3/2... 1018 0.0
                          gb|EU301213.1| Influenza A virus (A/aquatic bird/Korea/CN-4/2... 1014 0.0
                          emb|AJ704815.1| Influenza A virus (A/finch/China/R172/02(H3N2... 1009 0.0
                          emb|AJ427304.1|INA427304 Influenza A virus (A/pet bird/Hong K... 1000 0.0
                          emb|AJ841293.1| Influenza A virus (A/duck/Norway/1/03(H3N8)) ... 1000 0.0
                          emb|AM087217.1| Influenza A virus (A/mallard/Iran/V10/04(H3))... 998 0.0
                          gb|CY006016.1| Influenza A virus (A/duck/Nanchang/1681/1992(H... 996 0.0
                          gb|EU493448.1| Influenza A virus (A/mallard/Finland/12072/06(... 987 0.0
                          gb|EU301210.1| Influenza A virus (A/aquatic bird/Korea/CN-1/2... 987 0.0
                          gb|EF041487.1| Influenza A virus (A/duck/South Africa/1108/20... 984 0.0
                          gb|EU301220.1| Influenza A virus (A/aquatic bird/Korea/KN-5/2... 982 0.0
                          emb|AM087224.1| Influenza A virus (A/mallard/Germany/WV1303K/... 982 0.0
                          gb|CY006013.1| Influenza A virus (A/Chicken/Nanchang/7-010/20... 982 0.0
                          dbj|AB289341.1| Influenza A virus (A/swan/Shimane/227/01(H3N9... 978 0.0
                          gb|EU301211.1| Influenza A virus (A/aquatic bird/Korea/CN-2/2... 973 0.0
                          gb|CY006014.1| Influenza A virus (A/Quail/Nanchang/7-026/2000... 973 0.0
                          gb|AY531031.1| Influenza A virus (A/Mallard/65112/03(H3N8)) h... 973 0.0
                          gb|CY006015.1| Influenza A virus (A/Duck/Nanchang/8-174/2000(... 964 0.0
                          gb|M65018.1|FLAHAA Influenza A virus (A/equine/Jilin/1/1989(H... 955 0.0
                          gb|CY006011.1| Influenza A virus (A/Pigeon/Nanchang/9-058/200... 946 0.0
                          gb|CY006012.1| Influenza A virus (A/bantam/Nanchang/9-366/200... 946 0.0
                          dbj|AB292668.1| Influenza A virus (A/duck/Ukraine/1963(H3N8))... 942 0.0
                          emb|V01087.1|ORIN13 Hemagglutinin gene of influenza virus str... 942 0.0
                          gb|DQ021910.1| Influenza A virus (A/swine/Inner Mongolia/547/... 942 0.0
                          gb|CY006038.1| Influenza A virus (A/duck/UKR/1/1963(H3N8)) se... 937 0.0
                          gb|EU301217.1| Influenza A virus (A/aquatic bird/Korea/KN-2/2... 933 0.0
                          gb|EU301219.1| Influenza A virus (A/aquatic bird/Korea/KN-4/2... 928 0.0
                          gb|EU301216.1| Influenza A virus (A/aquatic bird/Korea/KN-1/2... 928 0.0
                          gb|EU301214.1| Influenza A virus (A/aquatic bird/Korea/JN-1/2... 928 0.0
                          emb|AJ506781.1|INA506781 Influenza A virus (A/teal/Germany/wv... 928 0.0
                          gb|AY857957.1| Influenza A virus (A/swine/Fujian/668/01(H3N2)... 926 0.0
                          gb|EU301218.1| Influenza A virus (A/aquatic bird/Korea/KN-3/2... 919 0.0
                          gb|EF151958.1| Influenza A virus (A/maned Goose/Netherlands/C... 915 0.0
                          emb|AJ697866.1| Influenza A virus (A/Nightingale/France/95125... 915 0.0
                          gb|AY531037.1| Influenza A virus (A/turkey/England/69 (H3N2))... 910 0.0
                          emb|AJ704816.1| Influenza A virus (A/pet bird/China/R7/04(H3N... 901 0.0
                          emb|AJ704814.1| Influenza A virus (A/finch/China/R170/02(H3N8... 901 0.0
                          dbj|AB277754.1| Influenza A virus (A/duck/Hokkaido/5/1977(H3N... 870 0.0
                          gb|M19056.1|FLAHAPA Influenza A virus (A/swine/Hong Kong/126/... 865 0.0
                          gb|M16740.1|FLAHA3DKD Influenza A virus (A/duck/7/1982(H3)) h... 861 0.0
                          dbj|D00930.1|FLA1076HA Influenza A virus (A/Gs/HK/10/1976(H3)... 859 0.0
                          gb|CY006026.1| Influenza A virus (A/duck/Hong Kong/7/1975(H3N... 856 0.0
                          dbj|D00929.1|FLA775HA Influenza A virus (A/DK/HK/7/1975(H3)) ... 856 0.0
                          gb|M16737.1|FLAHA3DKA Influenza A virus (A/duck/5/1977(H3)) h... 856 0.0
                          dbj|D00931.1|FLA6476HA Influenza A virus (A/duck/Hong Kong/64... 854 0.0
                          gb|M19057.1|FLAHAPB Influenza A virus (A/swine/Hong Kong/81/1... 852 0.0
                          dbj|AB275283.2| Influenza A virus (A/Duck/Hokkaido/8/80 (H3N8... 847 0.0
                          gb|CY014702.1| Influenza A virus (A/duck/Chabarovsk/1610/1972... 847 0.0
                          dbj|D21171.1|FLAHAD245 Influenza A virus (A/duck/Hong Kong/24... 847 0.0
                          gb|M16743.1|FLAHA3DKG Influenza A virus (A/duck/10/1985(H3)) ... 847 0.0
                          dbj|AB292660.1| Influenza A virus (A/duck/Hong Kong/22B/1976(... 843 0.0
                          dbj|AB292410.1| Influenza A virus (A/duck/Hong Kong/22A/1976(... 843 0.0
                          gb|AF079570.1|AF079570 Influenza A virus (A/Duck/Hokkaido/8/8... 843 0.0
                          dbj|D00932.1|FLA231HA Influenza A virus (A/duck/Hong Kong/231... 843 0.0
                          gb|CY022085.1| Influenza A virus (A/Albany/6/1968(H3N2)) segm... 838 0.0
                          gb|CY021109.1| Influenza A virus (A/Albany/17/1968(H3N2)) seg... 838 0.0
                          gb|CY020525.1| Influenza A virus (A/Albany/18/1968(H3N2)) seg... 838 0.0
                          dbj|AB276113.1| Influenza A virus (A/duck/Hokkaido/10/1985(H3... 838 0.0
                          gb|AY596800.1| Influenza A virus (A/common teal/Chany/N2/02(H... 838 0.0
                          gb|AY596799.1| Influenza A virus (A/common teal/Chany/N1/02(H... 838 0.0
                          gb|AY660996.1| Influenza A virus (A/Bilthoven/6449/71(H3N2)) ... 838 0.0
                          gb|K03338.1|FLAHAMN Influenza A virus (A/Qu/7/1970(H3N2)) hem... 838 0.0
                          gb|M16742.1|FLAHA3DKF Influenza A virus (A/duck/9/1985(H3)) h... 838 0.0
                          gb|M16739.1|FLAHA3DKC Influenza A virus (A/duck/33/1980(H3)) ... 838 0.0
                          gb|EF614251.1| Influenza A virus (A/Aichi/2/1968(H3N2)) hemag... 834 0.0
                          gb|EF614250.1| Influenza A virus (A/Aichi/2/1968(H3N2)) hemag... 834 0.0
                          gb|EF614249.1| Influenza A virus (A/Aichi/2/1968(H3N2)) hemag... 834 0.0
                          gb|CY021845.1| Influenza A virus (A/Albany/10/1968(H3N2)) seg... 834 0.0
                          gb|CY019891.1| Influenza A virus (A/Albany/11/1968(H3N2)) seg... 834 0.0
                          gb|CY008156.1| Influenza A virus (A/Beijing/1/68(H3N2)) segme... 834 0.0
                          gb|CY006299.1| Influenza A virus (A/Hong Kong/3/69(H3N2)) seg... 834 0.0
                          gb|CY006307.1| Influenza A virus (A/Hong Kong/50/72(H3N2)) se... 834 0.0

                          Comment


                          • #14
                            Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

                            Korea, China, Hong Kong, Norway (H3N8) (and then Iran, consistant with reports of less common Western Siberian southern migratory destinations, in ducks and geese)

                            emb|AJ841293.1| Influenza A virus (A/duck/Norway/1/03(H3N8))

                            From the interesting paper you cited, "recent H3N8 findings have been reported from Denmark in 2003 and Norway in 2005".

                            Further down the list,

                            gb|M65018.1|FLAHAA Influenza A virus (A/equine/Jilin/1/1989, H3N8)

                            Which is on the East Asian migratory flight path.

                            Duck---> Horse via ponds, wetlands

                            How did it go Duck/Horse to dog?

                            Contaminated water trough?

                            Comment


                            • #15
                              Re: Bird Flu Virus Crosses Species Barrier to Kill Dogs, Study Says

                              Here's another travel log. Notice that the human sequences with the best matches are from the late 60's early 70's even though the dog sequence was from 2007. Human sequences in other species evolve more slowly and serve as a reservoir for older human polymorphisms:

                              gb|AY862612.1| Influenza A virus (A/dove/Korea/S11/03(H3N2)) ... 42.1 0.015
                              gb|AY862610.1| Influenza A virus (A/duck/Korea/S9/03(H3N2)) h... 42.1 0.015
                              gb|AY862609.1| Influenza A virus (A/duck/Korea/S8/03(H3N2)) h... 42.1 0.015
                              gb|AY862608.1| Influenza A virus (A/duck/Korea/S7/03(H3N2)) h... 42.1 0.015
                              gb|AY862607.1| Influenza A virus (A/chicken/Korea/S6/03(H3N2)... 42.1 0.015
                              dbj|D00932.1|FLA231HA Influenza A virus (A/duck/Hong Kong/231... 42.1 0.015
                              dbj|AB298687.1| Influenza A virus (A/Memphis/1/71(H3N2)) HA g... 34.2 3.6
                              gb|EU493448.1| Influenza A virus (A/mallard/Finland/12072/06(... 34.2 3.6
                              gb|EU301240.1| Influenza A virus (A/duck/Korea/LPM92/2006(H3N... 34.2 3.6
                              gb|EU301239.1| Influenza A virus (A/duck/Korea/LPM91/2006(H3N... 34.2 3.6
                              gb|EU301238.1| Influenza A virus (A/chicken/Korea/LPM88/2006(... 34.2 3.6
                              gb|EU301237.1| Influenza A virus (A/duck/Korea/LPM86/2006(H3N... 34.2 3.6
                              gb|EU301236.1| Influenza A virus (A/chicken/Korea/LPM67/2006(... 34.2 3.6
                              gb|EU301235.1| Influenza A virus (A/duck/Korea/LPM66/2006(H3N... 34.2 3.6
                              gb|EU301234.1| Influenza A virus (A/chicken/Korea/LPM61/2005(... 34.2 3.6
                              gb|EU301233.1| Influenza A virus (A/duck/Korea/LPM56/2005(H3N... 34.2 3.6
                              gb|EU301232.1| Influenza A virus (A/chicken/Korea/LPM44/2005(... 34.2 3.6
                              gb|EU301231.1| Influenza A virus (A/chicken/Korea/LPM43/2005(... 34.2 3.6
                              gb|EU301230.1| Influenza A virus (A/duck/Korea/LPM39/2005(H3N... 34.2 3.6
                              gb|EU301229.1| Influenza A virus (A/duck/Korea/LPM38/2005(H3N... 34.2 3.6
                              gb|EU301228.1| Influenza A virus (A/duck/Korea/LPM36/2005(H3N... 34.2 3.6
                              gb|EU301227.1| Influenza A virus (A/duck/Korea/LPM23/2005(H3N... 34.2 3.6
                              gb|EU301226.1| Influenza A virus (A/duck/Korea/LPM22/2005(H3N... 34.2 3.6
                              gb|EU301225.1| Influenza A virus (A/duck/Korea/LPM18/2004(H3N... 34.2 3.6
                              gb|EU301224.1| Influenza A virus (A/chicken/Korea/LPM17/2004(... 34.2 3.6
                              gb|EU301223.1| Influenza A virus (A/duck/Korea/LPM09/2004(H3N... 34.2 3.6
                              gb|EU301222.1| Influenza A virus (A/chicken/Korea/LPM03/2004(... 34.2 3.6
                              gb|EU301221.1| Influenza A virus (A/duck/Korea/LPM01/2004(H3N... 34.2 3.6
                              gb|EU301220.1| Influenza A virus (A/aquatic bird/Korea/KN-5/2... 34.2 3.6
                              gb|EU301219.1| Influenza A virus (A/aquatic bird/Korea/KN-4/2... 34.2 3.6
                              gb|EU301217.1| Influenza A virus (A/aquatic bird/Korea/KN-2/2... 34.2 3.6
                              gb|EU301214.1| Influenza A virus (A/aquatic bird/Korea/JN-1/2... 34.2 3.6
                              gb|EU301213.1| Influenza A virus (A/aquatic bird/Korea/CN-4/2... 34.2 3.6
                              gb|EU301212.1| Influenza A virus (A/aquatic bird/Korea/CN-3/2... 34.2 3.6
                              gb|EU301211.1| Influenza A virus (A/aquatic bird/Korea/CN-2/2... 34.2 3.6
                              gb|EU301210.1| Influenza A virus (A/aquatic bird/Korea/CN-1/2... 34.2 3.6
                              gb|CY022946.1| Influenza A virus (A/Albany/3/1970(H3N2)) segm... 34.2 3.6
                              gb|CY022938.1| Influenza A virus (A/Albany/1/1970(H3N2)) segm... 34.2 3.6
                              gb|EF409245.1| Influenza A virus (A/Hong Kong/68(H3N2)) hemag... 34.2 3.6
                              gb|EF614251.1| Influenza A virus (A/Aichi/2/1968(H3N2)) hemag... 34.2 3.6
                              gb|EF614250.1| Influenza A virus (A/Aichi/2/1968(H3N2)) hemag... 34.2 3.6
                              gb|EF614249.1| Influenza A virus (A/Aichi/2/1968(H3N2)) hemag... 34.2 3.6
                              gb|EF614248.1| Influenza A virus (A/Aichi/2/1968(H3N2)) hemag... 34.2 3.6
                              gb|CY022085.1| Influenza A virus (A/Albany/6/1968(H3N2)) segm... 34.2 3.6
                              gb|EF626615.1| Influenza A virus (A/Hong Kong/107/1971(H3N2))... 34.2 3.6
                              gb|EF493185.1| Influenza A virus (A/kunke/1/71(H3N2)) truncat... 34.2 3.6
                              gb|CY021845.1| Influenza A virus (A/Albany/10/1968(H3N2)) seg... 34.2 3.6
                              gb|CY021837.1| Influenza A virus (A/Albany/4/1969(H3N2)) segm... 34.2 3.6
                              gb|CY021597.1| Influenza A virus (A/Memphis/3/1971(H3N2)) seg... 34.2 3.6
                              gb|DQ975252.1| Influenza A virus (A/swine/Italy/1850/1977(H3N... 34.2 3.6
                              gb|CY021117.1| Influenza A virus (A/Albany/6/1970(H3N2)) segm... 34.2 3.6
                              gb|CY021109.1| Influenza A virus (A/Albany/17/1968(H3N2)) seg... 34.2 3.6
                              gb|CY021085.1| Influenza A virus (A/Albany/2/1970(H3N2)) segm... 34.2 3.6
                              gb|CY020525.1| Influenza A virus (A/Albany/18/1968(H3N2)) seg... 34.2 3.6
                              dbj|AB295605.1| Influenza A virus (A/Aichi/2/1968(H3N2)) HA g... 34.2 3.6
                              dbj|AB292668.1| Influenza A virus (A/duck/Ukraine/1963(H3N8))... 34.2 3.6
                              dbj|AB292660.1| Influenza A virus (A/duck/Hong Kong/22B/1976(... 34.2 3.6
                              gb|CY019915.1| Influenza A virus (A/Albany/3/1969(H3N2)) segm... 34.2 3.6
                              gb|CY019907.1| Influenza A virus (A/Albany/19/1968(H3N2)) seg... 34.2 3.6
                              gb|CY019899.1| Influenza A virus (A/Albany/1/1969(H3N2)) segm... 34.2 3.6
                              gb|CY019891.1| Influenza A virus (A/Albany/11/1968(H3N2)) seg... 34.2 3.6
                              dbj|AB292410.1| Influenza A virus (A/duck/Hong Kong/22A/1976(... 34.2 3.6
                              dbj|AB289341.1| Influenza A virus (A/swan/Shimane/227/01(H3N9... 34.2 3.6
                              gb|EF151958.1| Influenza A virus (A/maned Goose/Netherlands/C... 34.2 3.6
                              dbj|AB284320.1| Influenza A virus (A/Aichi/2/1968(H3N2)) geno... 34.2 3.6
                              dbj|AB275283.2| Influenza A virus (A/Duck/Hokkaido/8/80 (H3N8... 34.2 3.6
                              dbj|AB277754.1| Influenza A virus (A/duck/Hokkaido/5/1977(H3N... 34.2 3.6
                              gb|EF041487.1| Influenza A virus (A/duck/South Africa/1108/20... 34.2 3.6
                              dbj|AB276113.1| Influenza A virus (A/duck/Hokkaido/10/1985(H3... 34.2 3.6
                              gb|CY014702.1| Influenza A virus (A/duck/Chabarovsk/1610/1972... 34.2 3.6
                              gb|CY011120.1| Influenza A virus (A/Northern Territory/60/196... 34.2 3.6
                              emb|AJ697865.1| Influenza A virus (A/Mallard/France/M-2515/01... 34.2 3.6
                              emb|AM087224.1| Influenza A virus (A/mallard/Germany/WV1303K/... 34.2 3.6
                              emb|AM087217.1| Influenza A virus (A/mallard/Iran/V10/04(H3))... 34.2 3.6
                              gb|CY003552.1| Influenza A virus (A/Hong Kong/6/72(H3N2)) seg... 34.2 3.6
                              gb|AY596801.1| Influenza A virus (A/garganey/Chany/N3/02(H3/N... 34.2 3.6
                              gb|AY596800.1| Influenza A virus (A/common teal/Chany/N2/02(H... 34.2 3.6
                              gb|AY596799.1| Influenza A virus (A/common teal/Chany/N1/02(H... 34.2 3.6
                              gb|CY002496.1| Influenza A virus (A/Memphis/1/71(H3N2)) segme... 34.2 3.6
                              gb|CY006015.1| Influenza A virus (A/Duck/Nanchang/8-174/2000(... 34.2 3.6
                              gb|CY006011.1| Influenza A virus (A/Pigeon/Nanchang/9-058/200... 34.2 3.6
                              gb|AY661040.1| Influenza A virus (A/Bilthoven/808/69(H3N2)) h... 34.2 3.6
                              gb|AY661039.1| Influenza A virus (A/Bilthoven/16190/68(H3N2))... 34.2 3.6
                              gb|AY661038.1| Influenza A virus (A/Bilthoven/15793/68(H3N2))... 34.2 3.6
                              gb|AY660999.1| Influenza A virus (A/Bilthoven/6022/72(H3N2)) ... 34.2 3.6
                              gb|AY660998.1| Influenza A virus (A/Bilthoven/21801/71(H3N2))... 34.2 3.6
                              gb|AY660997.1| Influenza A virus (A/Bilthoven/21438/71(H3N2))... 34.2 3.6
                              gb|AY660996.1| Influenza A virus (A/Bilthoven/6449/71(H3N2)) ... 34.2 3.6
                              gb|AY660995.1| Influenza A virus (A/Bilthoven/2668/70(H3N2)) ... 34.2 3.6
                              gb|AY660994.1| Influenza A virus (A/Bilthoven/93/70(H3N2)) he... 34.2 3.6
                              gb|AY660993.1| Influenza A virus (A/Bilthoven/17938/69(H3N2))... 34.2 3.6
                              gb|AY660992.1| Influenza A virus (A/Bilthoven/908/69(H3N2)) h... 34.2 3.6
                              gb|AY660991.1| Influenza A virus (A/Bilthoven/16398/68(H3N2))... 34.2 3.6
                              gb|CY006012.1| Influenza A virus (A/bantam/Nanchang/9-366/200... 34.2 3.6
                              dbj|D00931.1|FLA6476HA Influenza A virus (A/duck/Hong Kong/64... 34.2 3.6
                              emb|V01087.1|ORIN13 Hemagglutinin gene of influenza virus str... 34.2 3.6
                              gb|CY008156.1| Influenza A virus (A/Beijing/1/68(H3N2)) segme... 34.2 3.6
                              emb|V01103.1|ORINF6 Influenza A virus (A/NT/60/68/29C(H3N2)) ... 34.2 3.6
                              gb|AF348179.1|AF348179 Influenza A virus (A/Hong Kong/1/68(H3... 34.2 3.6
                              gb|AF348178.1|AF348178 Influenza A virus (A/Hong Kong/1/68(H3... 34.2 3.6
                              gb|AF348177.1|AF348177 Influenza A virus (A/Hong Kong/1/68(H3... 34.2 3.6
                              gb|AF348176.1|AF348176 Influenza A virus (A/Hong Kong/1/68(H3... 34.2 3.6
                              emb|AJ506781.1|INA506781 Influenza A virus (A/teal/Germany/wv... 34.2 3.6
                              emb|AJ427304.1|INA427304 Influenza A virus (A/pet bird/Hong K... 34.2 3.6
                              emb|AJ311454.1|INA311454 Influenza A virus partial HA gene fo... 34.2 3.6
                              emb|AJ289703.1|INA289703 Influenza A virus segment 4 gene for... 34.2 3.6
                              gb|DQ021910.1| Influenza A virus (A/swine/Inner Mongolia/547/... 34.2 3.6
                              gb|CY006026.1| Influenza A virus (A/duck/Hong Kong/7/1975(H3N... 34.2 3.6
                              emb|AJ704815.1| Influenza A virus (A/finch/China/R172/02(H3N2... 34.2 3.6
                              gb|AF201874.1|AF201874 Influenza A virus (A/Hong Kong/1/68(H3... 34.2 3.6
                              gb|AY531031.1| Influenza A virus (A/Mallard/65112/03(H3N8)) h... 34.2 3.6
                              emb|V01085.1| Influenza A virus (A/Aichi/2/68) gene for haema... 34.2 3.6
                              dbj|D21182.1|FLAHAS127 Influenza A virus (A/swine/Hong Kong/1... 34.2 3.6
                              dbj|D21171.1|FLAHAD245 Influenza A virus (A/duck/Hong Kong/24... 34.2 3.6
                              dbj|D21183.1|FLAHAS5 Influenza A virus (A/swine/Wadayama/5/69... 34.2 3.6
                              gb|AY862611.1| Influenza A virus (A/duck/Korea/S10/03(H3N2)) ... 34.2 3.6
                              gb|AF079570.1|AF079570 Influenza A virus (A/Duck/Hokkaido/8/8... 34.2 3.6
                              gb|CY006211.1| Influenza A virus (A/Memphis/1/68(H3N2)) segme... 34.2 3.6
                              gb|CY006219.1| Influenza A virus (A/Memphis/2/71(H3N2)) segme... 34.2 3.6
                              gb|CY006763.1| Influenza A virus (A/Nanjing/49/77(H3N2)) segm... 34.2 3.6
                              gb|CY006683.1| Influenza A virus (A/Hong Kong/46/71(H3N2)) se... 34.2 3.6
                              dbj|D00930.1|FLA1076HA Influenza A virus (A/Gs/HK/10/1976(H3)... 34.2 3.6
                              dbj|D00929.1|FLA775HA Influenza A virus (A/DK/HK/7/1975(H3)) ... 34.2 3.6
                              gb|CY006299.1| Influenza A virus (A/Hong Kong/3/69(H3N2)) seg... 34.2 3.6
                              gb|CY006307.1| Influenza A virus (A/Hong Kong/50/72(H3N2)) se... 34.2 3.6
                              gb|M55059.1|FLAHAZ Influenza A virus (A/Aichi/2/1968(H3N2)) h... 34.2 3.6
                              gb|M19057.1|FLAHAPB Influenza A virus (A/swine/Hong Kong/81/1... 34.2 3.6
                              gb|M19056.1|FLAHAPA Influenza A virus (A/swine/Hong Kong/126/... 34.2 3.6
                              gb|K03338.1|FLAHAMN Influenza A virus (A/Qu/7/1970(H3N2)) hem... 34.2 3.6
                              gb|J02132.1|FLAHALR Influenza A virus (A/Memphis/1/1971(H3N2)... 34.2 3.6
                              gb|K03335.1|FLAHALI Influenza A virus (A/England/878/1969(H3N... 34.2 3.6
                              gb|J02090.1|FLAHAL Influenza A virus (A/Aichi/2/1968(H3N2)) h... 34.2 3.6
                              gb|M16743.1|FLAHA3DKG Influenza A virus (A/duck/10/1985(H3)) ... 34.2 3.6
                              gb|M16742.1|FLAHA3DKF Influenza A virus (A/duck/9/1985(H3)) h... 34.2 3.6
                              gb|M16740.1|FLAHA3DKD Influenza A virus (A/duck/7/1982(H3)) h... 34.2 3.6
                              gb|M16739.1|FLAHA3DKC Influenza A virus (A/duck/33/1980(H3)) ... 34.2 3.6
                              gb|M16738.1|FLAHA3DKB Influenza A virus (A/duck/8/1980(H3)) h... 34.2 3.6
                              gb|M16737.1|FLAHA3DKA Influenza A virus (A/duck/5/1977(H3)) h... 34.2 3.6

                              Comment

                              Working...
                              X