• FluTrackers.com Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster. The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website. By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
  • We are not asking for any donations. Do not donate to any entity who says they are raising funds for us.

China: EV-71 outbreak Kills 43 Children Nationwide, 24,934 Children infected

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

05/05/2008, Monday in the morning 06:23



The European Taiwan practice of medicine alliance protested that Beijing has not notified the EV71 epidemic situation to Taiwan
2008-05-04 22:45

[on.cc special news]The European Taiwan practice of medicine alliance sent a letter to World Health Organization Secretary General Chen Feng Fuzhen last Saturday, protested that the WHO and Beijing authority, has not notified enteritis epidemic situation which promptly to Taiwan erupted in the mainland, the European Taiwan practice of medicine alliance pointed out recently in the correspondence, the past for 10 years, and west the Pacific section once had erupted several times the EV71 enteritis in Southeast Asia, in 1997 and in 1998 separately caused below the hundreds of 15 years old in Malaysia and Taiwan the child to die the case, but the WHO and the mainland has not faced up to this disease. The correspondence middle finger, we did not hope that at the appointed time has more people to fall ill or the death again.:tiphat: http://svsurl.systransoft.com/?t=ou...sk=11d1def534ea1be0-3d1e4877-119aefd99fb-133a
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

05/05/2008, Monday in the morning 01:07



Inland sick children do not isolate the terminal velocity spread

[Eastern daily paper special news]Enteritis captures is close to Hong Kong's Shenzhen, the Baoan famous young child suffers from the hand and foot stomatopathy, but the local hospital has not isolated examines the patient, the resident worried that ?sees a doctor, gives an injection? the sick children to gather in the same place, accelerates the EV71 epidemic situation the spread. The National Medical department night before last late at night urgently issued that ?the hand and foot stomatopathy anticipatory control guide?, decided integrates the third kind of infectious disease the hand and foot stomatopathy to manage, various provinces every Friday needs to report a time newest situation.

Arranges in order the third kind of infectious disease to admonish the promotion
鑑 enteritis EV71 epidemic situation which erupts in Anhui Fuyang (hand and foot stomatopathy) still in the spread, the medical department night before last urgent decision this epidemic situation included the third kind of infectious disease to manage. Various provinces and cities autonomous region every Friday must the case case Survey result, pass on to the China CDC disease control and the emergency processing office. The medical department also issued the notification in yesterday, up to May 1, Anhui Fuyang accumulated the report hand and foot stomatopathy 3321 examples, died 22 examples, has cured 1112 examples. Moreover, the hand and foot stomatopathy already south inland the local spread, according to "South Metropolis Newspaper" quotes valuable Anlung China street scenery dragon community Ms. Zhu to point out that on April 29 afternoon, year-old a many daughter and the neighbor child has played a meeting, the second day discovers in the daughter hand, the thigh inside to have the blister, escorts to the dragon China People's Hospital diagnosis immediately. On May 1, is diagnosed by the dermatology department for the hand and foot stomatopathy. Ms. Zhu the neighbor child also presents the similar illness, after delivering the medicine, is also diagnosed for the hand and foot stomatopathy. It is said that in this plot four children have contracted this kind of sickness at least. However, the dragon China People's Hospital said that only receives a doubtful hand and foot stomatopathy case, has not taken any quarantine measures as for the hospital to the doubtful patient, the hospital response said that the hospital does not have the infectious disease branch, only then the diagnosis hand and foot stomatopathy patient, diligently will only then achieve the relative isolation.:tiphat: http://svsurl.systransoft.com/?t=ou...sk=11d1def534ea1be0-3d1e4877-119aefd99fb--750
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Pupil's rash sparks panic in parents at Bedworth school
Apr 30 2008 By Catherine Vonledebur

PREVENTATIVE health and safety measures have been taken at a primary school following an outbreak of hand, foot and mouth disease.

On Friday, staff at Newdigate Primary School in Anderton Road, Bedworth, were notified by a parent that a child was found by their doctor to have the common viral illness - completely unrelated to foot and mouth disease which affects cattle, sheep and pigs.

Head teacher Chris Cook immediately contacted Warwickshire County Council and the Health Protection Agency (HPA) who advised her on appropriate action to take.

A handful of other cases have been confirmed at the 237-pupil school between Coventry and Nuneaton.

As a preventative measure antiseptic gel is available in all classrooms.

Hand foot and mouth disease gets its name from a rash which develops on the palms of the hands and soles of the feet. It can also cause sores in the mouth.

The disease is easily spread and particularly common in children aged under 10. A number of panic-striken parents had confused the out-break with foot and mouth disease.

All parents have been sent a letter and an HPA information leaflet about hand, foot and mouth disease.

A statement from Newdigate Primary School said: "Hand, foot and mouth disease is not the same thing as foot and mouth disease, which affects cattle, sheep and pigs. The two infections are completely unrelated, and you cannot contract hand, foot and mouth disease from animals.

"Hand, foot and mouth dis-ease is easily spread and it is common in children under 10 and therefore often affects children attending nurseries and primary schools.

"We have had a handful of cases at Newdigate Primary School and we have written to parents to advise them of this and to give them information about the illness.

"As soon as we knew one of our pupils had hand, foot and mouth we contacted the local authority and the Health Protection Agency.

"As a preventative measure, and to avoid contamination in school, we have ensured that antiseptic gel is in all classrooms and the school is maintained to a very clean standard."

Before the outbreak was confirmed one concerned mother of a five-year-old boy at the school, mistook it to be the disease affecting animals. The 32-year-old, who did not wish to be named, said: " Many parents were worried and wanted to know why we weren't told sooner."

NO LINK TO ANIMAL FOOT AND MOUTH DISEASE

* Hand, foot and mouth disease is a viral illness. The virus which causes it is quite different from that of foot and mouth disease, which affects animals.

* The symptoms include fever, sore mouth and the development of a rash. Blisters can appear on the inside of the cheeks, gums and side of the tongue. A rash can occur on the palms, fingers and soles of feet.

* The disease is more common in summer and early autumn, mainly in children under 10 years old. Outbreaks frequently occur in groups of children in a nursery school, for example.

* The virus is spread by direct contact through coughing and sneezing. Coughing and sneezing are also likely to contaminate hands which if not washed thoroughly may transmit infection.

* To prevent the spread of disease, children should be kept away from school while unwell. There is no need to keep a child away from school until the last blister has disappeared provided he/she is otherwise well.

* Regular handwashing and drying should be encouraged.

* No specific treatment or immunisation is given for this disease.




CAN ANYONE TELL ME IF THIS IS THE SAME DISEASE PLEASE,THIS SCHOOL IS CLOSE TO WHERE I LIVE,THANKS.







http://www.coventrytelegraph.net/ne...in-parents-at-bedworth-school-92746-20841670/
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Pupil's rash sparks panic in parents at Bedworth school
Apr 30 2008 By Catherine Vonledebur

PREVENTATIVE health and safety measures have been taken at a primary school following an outbreak of hand, foot and mouth disease.

On Friday, staff at Newdigate Primary School in Anderton Road, Bedworth, were notified by a parent that a child was found by their doctor to have the common viral illness - completely unrelated to foot and mouth disease which affects cattle, sheep and pigs.

Head teacher Chris Cook immediately contacted Warwickshire County Council and the Health Protection Agency (HPA) who advised her on appropriate action to take.

A handful of other cases have been confirmed at the 237-pupil school between Coventry and Nuneaton.

As a preventative measure antiseptic gel is available in all classrooms.

Hand foot and mouth disease gets its name from a rash which develops on the palms of the hands and soles of the feet. It can also cause sores in the mouth.

The disease is easily spread and particularly common in children aged under 10. A number of panic-striken parents had confused the out-break with foot and mouth disease.

All parents have been sent a letter and an HPA information leaflet about hand, foot and mouth disease.

A statement from Newdigate Primary School said: "Hand, foot and mouth disease is not the same thing as foot and mouth disease, which affects cattle, sheep and pigs. The two infections are completely unrelated, and you cannot contract hand, foot and mouth disease from animals.

"Hand, foot and mouth dis-ease is easily spread and it is common in children under 10 and therefore often affects children attending nurseries and primary schools.

"We have had a handful of cases at Newdigate Primary School and we have written to parents to advise them of this and to give them information about the illness.

"As soon as we knew one of our pupils had hand, foot and mouth we contacted the local authority and the Health Protection Agency.

"As a preventative measure, and to avoid contamination in school, we have ensured that antiseptic gel is in all classrooms and the school is maintained to a very clean standard."

Before the outbreak was confirmed one concerned mother of a five-year-old boy at the school, mistook it to be the disease affecting animals. The 32-year-old, who did not wish to be named, said: " Many parents were worried and wanted to know why we weren't told sooner."

NO LINK TO ANIMAL FOOT AND MOUTH DISEASE

* Hand, foot and mouth disease is a viral illness. The virus which causes it is quite different from that of foot and mouth disease, which affects animals.

* The symptoms include fever, sore mouth and the development of a rash. Blisters can appear on the inside of the cheeks, gums and side of the tongue. A rash can occur on the palms, fingers and soles of feet.

* The disease is more common in summer and early autumn, mainly in children under 10 years old. Outbreaks frequently occur in groups of children in a nursery school, for example.

* The virus is spread by direct contact through coughing and sneezing. Coughing and sneezing are also likely to contaminate hands which if not washed thoroughly may transmit infection.

* To prevent the spread of disease, children should be kept away from school while unwell. There is no need to keep a child away from school until the last blister has disappeared provided he/she is otherwise well.

* Regular handwashing and drying should be encouraged.

* No specific treatment or immunisation is given for this disease.




CAN ANYONE TELL ME IF THIS IS THE SAME DISEASE PLEASE,THIS SCHOOL IS CLOSE TO WHERE I LIVE,THANKS.







http://www.coventrytelegraph.net/ne...in-parents-at-bedworth-school-92746-20841670/
Yes, it is almost certainly EV-71, but not necessarily the same strain causing deaths in China.
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Pupil's rash sparks panic in parents at Bedworth school
Apr 30 2008 By Catherine Vonledebur

PREVENTATIVE health and safety measures have been taken at a primary school following an outbreak of hand, foot and mouth disease.

On Friday, staff at Newdigate Primary School in Anderton Road, Bedworth, were notified by a parent that a child was found by their doctor to have the common viral illness - completely unrelated to foot and mouth disease which affects cattle, sheep and pigs.

Head teacher Chris Cook immediately contacted Warwickshire County Council and the Health Protection Agency (HPA) who advised her on appropriate action to take.

A handful of other cases have been confirmed at the 237-pupil school between Coventry and Nuneaton.

As a preventative measure antiseptic gel is available in all classrooms.

Hand foot and mouth disease gets its name from a rash which develops on the palms of the hands and soles of the feet. It can also cause sores in the mouth.

The disease is easily spread and particularly common in children aged under 10. A number of panic-striken parents had confused the out-break with foot and mouth disease.

All parents have been sent a letter and an HPA information leaflet about hand, foot and mouth disease.

A statement from Newdigate Primary School said: "Hand, foot and mouth disease is not the same thing as foot and mouth disease, which affects cattle, sheep and pigs. The two infections are completely unrelated, and you cannot contract hand, foot and mouth disease from animals.

"Hand, foot and mouth dis-ease is easily spread and it is common in children under 10 and therefore often affects children attending nurseries and primary schools.

"We have had a handful of cases at Newdigate Primary School and we have written to parents to advise them of this and to give them information about the illness.

"As soon as we knew one of our pupils had hand, foot and mouth we contacted the local authority and the Health Protection Agency.

"As a preventative measure, and to avoid contamination in school, we have ensured that antiseptic gel is in all classrooms and the school is maintained to a very clean standard."

Before the outbreak was confirmed one concerned mother of a five-year-old boy at the school, mistook it to be the disease affecting animals. The 32-year-old, who did not wish to be named, said: " Many parents were worried and wanted to know why we weren't told sooner."

NO LINK TO ANIMAL FOOT AND MOUTH DISEASE

* Hand, foot and mouth disease is a viral illness. The virus which causes it is quite different from that of foot and mouth disease, which affects animals.

* The symptoms include fever, sore mouth and the development of a rash. Blisters can appear on the inside of the cheeks, gums and side of the tongue. A rash can occur on the palms, fingers and soles of feet.

* The disease is more common in summer and early autumn, mainly in children under 10 years old. Outbreaks frequently occur in groups of children in a nursery school, for example.

* The virus is spread by direct contact through coughing and sneezing. Coughing and sneezing are also likely to contaminate hands which if not washed thoroughly may transmit infection.

* To prevent the spread of disease, children should be kept away from school while unwell. There is no need to keep a child away from school until the last blister has disappeared provided he/she is otherwise well.

* Regular handwashing and drying should be encouraged.

* No specific treatment or immunisation is given for this disease.




CAN ANYONE TELL ME IF THIS IS THE SAME DISEASE PLEASE,THIS SCHOOL IS CLOSE TO WHERE I LIVE,THANKS.







http://www.coventrytelegraph.net/ne...in-parents-at-bedworth-school-92746-20841670/

LOCUS AM939639 1386 bp RNA linear VRL 29-APR-2008
DEFINITION Human enterovirus 71 EP/449/2000 partial 3D pol gene for polymerase
3D, genomic RNA.
ACCESSION AM939639
VERSION AM939639.1 GI:186929183
KEYWORDS .
SOURCE Human enterovirus 71 EP/449/2000
ORGANISM Human enterovirus 71 EP/449/2000
Viruses; ssRNA positive-strand viruses, no DNA stage;
Picornavirales; Picornaviridae; Enterovirus; Human enterovirus A.
REFERENCE 1
AUTHORS Bible,J.M., Pantelidis,P., Bendig,J.W., Iturriza-Gomara,M.,
Brown,D. and Tong,W.
TITLE Continuous circulation of Enterovirus 71 genotype C in the United
Kingdom from 1998-2006 with repeated introduction of new strains
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1386)
AUTHORS Bible,J.M.
TITLE Direct Submission
JOURNAL Submitted (29-JAN-2008) Bible J.M., Infection & Immunology Delivery
Unit, St Thomas' Hospital, London, SE17EH, United Kingdom
FEATURES Location/Qualifiers
source 1..1386
/organism="Human enterovirus 71 EP/449/2000"
/virion
/mol_type="genomic RNA"
/strain="EP/449/2000"
/db_xref="taxon:500043"
gene <1..>1386
/gene="3D pol"
CDS <1..>1386
/gene="3D pol"
/function="RNA polymerase"
/codon_start=1
/product="polymerase 3D"
/protein_id="CAP74070.1"
/db_xref="GI:186929184"
/translation="GEIQWMKPNKETGRLNINGPTRTKLEPSVFHDVFEGTKEPAVLT
SKDPRLEVDFEQALFSKYVGNTLHEPDEFVREAALHYANQLKQLDIKTTKMSIEDACY
GTENLEAIDLHTSAGYPYSALGIKKRDILDPTTRDVSKMKFYMDKYGLDLPYSTYVKD
ELRAIDKIKKGKSRLIEASSLNDSVYLRMTFGHLYEIFHANPGTVTGSAVGCNPDVFW
SKLPILLPGSLFAFDYSGYDASLSPVWFRALEIVLREIGYSEEAVSLIEGINHTHHVY
RNKTYCVLGGMPSGCSGTSIFNSMINNIIIRTLLIKTFKGIDLDELNMVAYGDDVLAS
YPFPIDCLELAKTGKEYGLTMTPADKSPCFNEVTWENATFLKRGFLPDHQFPFLIHPT
MPMKEIHESIRWTKDARNTQDHVRSLCLLAWHNGKEEYEKFVSTIRSVPIGKALAIPN
FENLRRNWLELF"
ORIGIN
1 ggtgagatcc agtggatgaa gcccaacaaa gaaactggta ggttgaacat taatgggcct
61 actcgtacca aacttgagcc aagtgtcttt catgatgtgt tcgagggtac caaagaacca
121 gcagtgttga ctagcaaaga cccaaggttg gaagttgatt ttgagcaggc tttgttttca
181 aagtacgtgg gaaacacgct ccacgagccc gacgaatttg tcagggaggc ggctttgcac
241 tatgccaacc aactcaaaca gttagacatc aagaccacca aaatgagcat agaggatgct
301 tgctatggta cagagaacct ggaagctata gatcttcaca ctagtgcagg atacccatac
361 agtgcgctag gaatcaagaa aagggatatt ttggacccaa caactcgcga tgtcagtaaa
421 atgaaatttt acatggataa gtatgggttg gatctcccat attctactta tgttaaagac
481 gagctcaggg ccattgacaa gatcaagaaa gggaagtccc gtctcataga agcgagcagt
541 ctaaatgact cagtgtactt gaggatgaca tttgggcacc tttatgaaat cttccacgcc
601 aatccaggta cagtcaccgg ttcagctgtt ggatgtaacc cagatgtgtt ttggagtaag
661 ttaccaatct tactcccagg atcgctcttt gcgttcgact actcagggta tgatgctagt
721 ctcagcccag tgtggttcag ggcgttggag atagtcctgc gggaaattgg atactctgag
781 gaagcagtgt ctctcataga agggatcaac cacacccacc atgtgtaccg caataaaact
841 tattgtgtcc ttggaggaat gccctcaggt tgctcaggta cctccatttt caactcgatg
901 attaataata tcattatcag gacacttttg atcaaaacat tcaaggggat agatctagat
961 gaattgaaca tggtagccta tggggacgat gtgttagcta gttatccctt cccaattgat
1021 tgtctagaat tggcaaaaac aggtaaggag tatgggctga ctatgacccc tgctgacaaa
1081 tcaccctgtt ttaatgaagt cacgtgggag aatgccacct tcctaaagag aggattcttg
1141 cctgatcatc agttcccgtt cctcattcac cctacgatgc caatgaagga gattcacgag
1201 tctattcgct ggaccaaaga cgcacgaaac actcaagacc acgtgcgctc cctctgcttg
1261 ctagcatggc acaatgggaa agaggagtat gaaaaatttg taagcacaat tagatcggtt
1321 ccaattggga aagcattagc tataccaaat tttgagaacc tgagaagaaa ttggcttgaa
1381 ttgttt
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

TITLE Continuous circulation of Enterovirus 71 genotype C in the United
Kingdom from 1998-2006 with repeated introduction of new strains
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Top 100 sequences related to EV-71 from UK from 2000

emb|AM939594.1| Human enterovirus 71 EP/449/2000 partial VP1 ... 1608 0.0
emb|AM939593.1| Human enterovirus 71 EP/17728/1998 partial VP... 1590 0.0
gb|AY207612.1| Human enterovirus 71 isolate 03784-MAA-97 VP1 ... 1572 0.0
gb|AF190574.1|AF190574 Enterovirus 71 isolate 1116-MAA-98 VP1... 1566 0.0
gb|AF190573.1|AF190573 Enterovirus 71 isolate 1115-MAA-98 VP1... 1566 0.0
gb|AF190567.1|AF190567 Enterovirus 71 isolate 1112-MAA-97 VP1... 1566 0.0
gb|AF135935.1|AF135935 Enterovirus 71 strain 0756-MAA-97 caps... 1566 0.0
emb|AM939588.1| Human enterovirus 71 EP/9027/1999 partial VP1... 1563 0.0
gb|AY207629.1| Human enterovirus 71 isolate 0838-MAA-99 VP1 p... 1563 0.0
gb|AF376120.1|AF376120 Human enterovirus 71 strain 4575/SIN/9... 1563 0.0
gb|AF190575.1|AF190575 Enterovirus 71 isolate 1117-MAA-98 VP1... 1563 0.0
gb|AF190572.1|AF190572 Enterovirus 71 isolate 1114-MAA-98 VP1... 1563 0.0
gb|AF190568.1|AF190568 Enterovirus 71 isolate 1113-MAA-97 VP1... 1563 0.0
gb|AY207653.1| Human enterovirus 71 isolate 0749-MAA-99 VP1 p... 1557 0.0
gb|AY207630.1| Human enterovirus 71 isolate 0808-MAA-98 VP1 p... 1557 0.0
gb|AF190576.1|AF190576 Enterovirus 71 isolate 1118-MAA-98 VP1... 1557 0.0
gb|AF190565.1|AF190565 Enterovirus 71 isolate 1109-MAA-97 VP1... 1557 0.0
emb|AM939596.1| Human enterovirus 71 EP/4709/2001 partial VP1... 1553 0.0
gb|AY207638.1| Human enterovirus 71 isolate 0283-MAA-97 VP1 p... 1553 0.0
gb|AY207631.1| Human enterovirus 71 isolate 0557-MAA-98 VP1 p... 1548 0.0
emb|AM939592.1| Human enterovirus 71 EP/13372/1998 partial VP... 1544 0.0
emb|AM939590.1| Human enterovirus 71 EP/11168/2000 partial VP... 1539 0.0
emb|AM939577.1| Human enterovirus 71 EP/2063/2001 partial VP1... 1539 0.0
gb|AF376098.1|AF376098 Human enterovirus 71 strain 1M/AUS/12/... 1539 0.0
emb|AM939582.1| Human enterovirus 71 EP/3267/2002 partial VP1... 1535 0.0
gb|DQ341361.1| Human enterovirus 71 isolate 1M-AUS-12-00, com... 1535 0.0
emb|AM939595.1| Human enterovirus 71 EP/12105/2001 partial VP... 1530 0.0
emb|AM939589.1| Human enterovirus 71 EP/11052/2001 partial VP... 1530 0.0
emb|AM939586.1| Human enterovirus 71 EP/8277/2001 partial VP1... 1530 0.0
dbj|AB115495.1| Human enterovirus 71 VP1 gene for polyprotein... 1530 0.0
emb|AM939584.1| Human enterovirus 71 EP/5746/2001 partial VP1... 1526 0.0
emb|AM939581.1| Human enterovirus 71 EP/2826/2002 partial VP1... 1526 0.0
emb|AM939579.1| Human enterovirus 71 EP/2353/2002 partial VP1... 1526 0.0
gb|AF376087.1|AF376087 Human enterovirus 71 strain S40221/SAR... 1526 0.0
emb|AM939591.1| Human enterovirus 71 EP/12081/2001 partial VP... 1521 0.0
emb|AM939580.1| Human enterovirus 71 EP/2405/2001 partial VP1... 1521 0.0
gb|DQ341358.1| Human enterovirus 71 isolate S40221-SAR-00, co... 1521 0.0
gb|AY207626.1| Human enterovirus 71 isolate 0389-MAA-00 VP1 p... 1517 0.0
gb|AY207625.1| Human enterovirus 71 isolate 0113-MAA-00 VP1 p... 1517 0.0
gb|AY207618.1| Human enterovirus 71 isolate 0807-MAA-00 VP1 p... 1517 0.0
gb|AY207634.1| Human enterovirus 71 isolate 0774-MAA-00 VP1 p... 1514 0.0
gb|AY207622.1| Human enterovirus 71 isolate 0948-MAA-00 VP1 p... 1512 0.0
gb|AY207621.1| Human enterovirus 71 isolate 0937-MAA-00 VP1 p... 1512 0.0
gb|DQ341360.1| Human enterovirus 71 isolate J115-MAL-01, comp... 1508 0.0
gb|AY207619.1| Human enterovirus 71 isolate 0836-MAA-00 VP1 p... 1508 0.0
gb|AY258318.1| Human enterovirus 71 isolate 5026-SIN-02 VP1 p... 1503 0.0
gb|AY207635.1| Human enterovirus 71 isolate 05716-MAA-00 VP1 ... 1503 0.0
gb|AY207632.1| Human enterovirus 71 isolate 0832-MAA-00 VP1 p... 1503 0.0
gb|AY207620.1| Human enterovirus 71 isolate 0915-MAA-00 VP1 p... 1503 0.0
emb|AM939587.1| Human enterovirus 71 EP/8300/2004 partial VP1... 1499 0.0
gb|AY258317.1| Human enterovirus 71 isolate CN30014-SAR-03 VP... 1490 0.0
gb|AY258298.1| Human enterovirus 71 isolate SB9564-SAR-03 VP1... 1490 0.0
gb|DQ452074.1| Human enterovirus 71 strain 804/NO/03, complet... 1485 0.0
gb|AY258319.1| Human enterovirus 71 isolate 4381-SIN-02 VP1 p... 1485 0.0
gb|AY258316.1| Human enterovirus 71 isolate CN30552-SAR-03 VP... 1485 0.0
gb|AY258302.1| Human enterovirus 71 isolate SB9465-SAR-03 VP1... 1485 0.0
gb|AY258300.1| Human enterovirus 71 isolate SB9522-SAR-03 VP1... 1485 0.0
gb|AY258299.1| Human enterovirus 71 isolate SB9533-SAR-03 VP1... 1485 0.0
gb|AY258296.1| Human enterovirus 71 isolate SB9582-SAR-03 VP1... 1485 0.0
gb|AY258315.1| Human enterovirus 71 isolate S19691-SAR-03 VP1... 1481 0.0
gb|AY258312.1| Human enterovirus 71 isolate S19761-SAR-03 VP1... 1481 0.0
gb|AY258301.1| Human enterovirus 71 isolate SB9508-SAR-03 VP1... 1481 0.0
gb|AY258297.1| Human enterovirus 71 isolate SB9579-SAR-03 VP1... 1481 0.0
gb|AY258295.1| Human enterovirus 71 isolate SB9604-SAR-03 VP1... 1481 0.0
emb|AM939598.1| Human enterovirus 71 H0/5440/288/2005 partial... 1476 0.0
gb|AY258314.1| Human enterovirus 71 isolate S19731-SAR-03 VP1... 1476 0.0
gb|AY258294.1| Human enterovirus 71 isolate SB9869-SAR-03 VP1... 1472 0.0
emb|AM939606.1| Human enterovirus 71 H0/6344/348/2006 partial... 1467 0.0
emb|AM939605.1| Human enterovirus 71 H0/6290/135/2006 partial... 1467 0.0
emb|AM939603.1| Human enterovirus 71 H0/5454/265/2005 partial... 1467 0.0
emb|AM939601.1| Human enterovirus 71 H0/6290/136/2006 partial... 1467 0.0
emb|AM939600.1| Human enterovirus 71 H0/6334/528/2006 partial... 1467 0.0
emb|AM939602.1| Human enterovirus 71 H0/6344/349/2006 partial... 1463 0.0
emb|AM490156.1| Human enterovirus A partial gene for polyprot... 1463 0.0
emb|AM939578.1| Human enterovirus 71 H0/6314/248/2006 partial... 1458 0.0
emb|AM490157.1| Human enterovirus A partial gene for polyprot... 1454 0.0
gb|AF135937.1|AF135937 Enterovirus 71 strain 2132-VA-95 capsi... 1453 0.0
gb|AF135933.1|AF135933 Enterovirus 71 strain 0443-TX-91 capsi... 1453 0.0
gb|AF009556.1|AF009556 Enterovirus 71 isolate 2037-MD-95 poly... 1447 0.0
gb|AF009554.1|AF009554 Enterovirus 71 isolate 2006-CT-94 poly... 1447 0.0
gb|AF009544.1|AF009544 Enterovirus 71 isolate 2253-NY-94 poly... 1447 0.0
gb|AF009559.1|AF009559 Enterovirus 71 isolate 1873-CT-93 poly... 1440 0.0
gb|AF009543.1|AF009543 Enterovirus 71 isolate 2251-NY-93 poly... 1438 0.0
gb|AF135953.1|AF135953 Enterovirus 71 strain 8495-VA-88 capsi... 1436 0.0
gb|AF135954.1|AF135954 Enterovirus 71 strain 9166-TX-89 capsi... 1429 0.0
gb|AF135959.1|AF135959 Enterovirus 71 strain 9873-NM-89 capsi... 1425 0.0
gb|AF135956.1|AF135956 Enterovirus 71 strain 9323-TX-89 capsi... 1425 0.0
gb|AF009557.1|AF009557 Enterovirus 71 isolate 9541-TX-89 poly... 1425 0.0
gb|AF009545.1|AF009545 Enterovirus 71 isolate 2254-NY-94 poly... 1425 0.0
gb|AY722885.1| Human enterovirus 71 strain 8005-SYD-86 VP1 (V... 1425 0.0
gb|AY189154.1|AY189153S2 Human enterovirus 71 S18191/SAR/02 V... 1422 0.0
gb|AF009551.1|AF009551 Enterovirus 71 isolate 1411-CA-90 poly... 1420 0.0
gb|AY722886.1| Human enterovirus 71 strain 7610-SYD-86 VP1 (V... 1420 0.0
gb|AY722896.1| Human enterovirus 71 strain 3717-SYD-86 VP1 (V... 1418 0.0
gb|AY722894.1| Human enterovirus 71 strain 7870-SYD-86 VP1 (V... 1418 0.0
gb|AF135945.1|AF135945 Enterovirus 71 strain 2623-AUS-86 caps... 1416 0.0
gb|AF135940.1|AF135940 Enterovirus 71 strain 2263-CA-94 capsi... 1416 0.0
gb|AY722895.1| Human enterovirus 71 strain 3032-SYD-86 VP1 (V... 1416 0.0
gb|AY722893.1| Human enterovirus 71 strain 5408-SYD-86 VP1 (V... 1413 0.0
gb|AY722891.1| Human enterovirus 71 strain 5409-SYD-86 VP1 (V... 1413 0.0
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

LOCUS AY258302 891 bp RNA linear VRL 31-DEC-2003
DEFINITION Human enterovirus 71 isolate SB9465-SAR-03 VP1 protein (VP1) gene,
partial cds.
ACCESSION AY258302
VERSION AY258302.1 GI:32442238
KEYWORDS .
SOURCE Human enterovirus 71
ORGANISM Human enterovirus 71
Viruses; ssRNA positive-strand viruses, no DNA stage;
Picornavirales; Picornaviridae; Enterovirus; Human enterovirus A.
REFERENCE 1 (bases 1 to 891)
AUTHORS Cardosa,M.J., Podin,Y., Leong,Y.W., Perera,D., McMinn,P. and
Kiyu,A.
TITLE Emergence of a new subgenogroup of human enterovirus 71 in a
outbreak of hand, foot and mouth disease in Sarawak, Malaysia
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 891)
AUTHORS Cardosa,M.J., Podin,Y., Leong,Y.W., Perera,D., McMinn,P. and
Kiyu,A.
TITLE Direct Submission
JOURNAL Submitted (19-MAR-2003) Institute of Health and Community Medicine,
Universiti Malaysia Sarawak, Kota Samarahan, Sarawak 94300,
Malaysia
FEATURES Location/Qualifiers
source 1..891
/organism="Human enterovirus 71"
/virion
/mol_type="genomic RNA"
/isolate="SB9465-SAR-03"
/db_xref="taxon:39054"
gene <1..>891
/gene="VP1"
CDS <1..>891
/gene="VP1"
/codon_start=1
/product="VP1 protein"
/protein_id="AAP82190.1"
/db_xref="GI:32442239"
/translation="GDRVADVIESSIGDSVSRALTQALPAPTGQNTQVSSHRLDTGKV
PALQAAEIGASSNASDESMIETRCVLNSHSTAETTLDSFFSRAGLVGEIDLPLEGTTN
PNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGA
PKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEK
DLEYGACPNNMMGTFSVRTVGTSKSKYPLVIRIYMRMKHVRAWVPRPMRNQNYLFKAN
PNYAGNSIKPTGTSRTAITTL"
ORIGIN
1 ggtgataggg tggcggatgt gattgagagt tctatagggg atagtgtgag cagagctctc
61 actcaagctt taccagcacc cacaggccaa aacacgcaag taagcagcca ccggttggac
121 actggtaaag tcccagcact tcaagccgct gaaattggag catcatcaaa tgctagtgac
181 gagagtatga ttgagacacg gtgtgttctc aattcgcaca gcacagctga gaccactctc
241 gatagtttct ttagcagagc ggggctagtt ggagagatag acctccctct cgaaggcaca
301 accaacccga atggttatgc taactgggac atagatataa caggttatgc acaaatgcgt
361 agaaaggtgg agctgttcac ttacatgcgt ttcgatgcag agttcacctt cgttgcatgt
421 acgcccaccg gggaggttgt cccacaattg ctccaataca tgtttgtgcc acctggggct
481 cccaagccag actccagaga atccctcgca tggcaaactg ccaccaatcc ctcggttttt
541 gttaagttat cagatccccc agcacaggtc tcagttccat tcatgtcacc tgcgagtgcc
601 tatcaatggt tctatgatgg atatcccacg ttcggtgagc acaagcagga gaaagacctt
661 gaatatgggg catgtccaaa caatatgatg ggcacgttct cagttcggac cgtgggaact
721 tcgaaatcca agtacccttt ggtgattagg atttacatga ggatgaagca cgtcagggcg
781 tgggtgcctc gcccaatgcg caaccaaaat tatctattca aggccaaccc aaattatgcc
841 ggtaactcca ttaagccaac tggtaccagt cgcacggcga ttaccaccct t
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

<TABLE cellSpacing=0 cellPadding=5 width=600 border=0><TBODY><TR><TD align=right width=155>08:29, May 05, 2008</TD></TR></TBODY></TABLE>
dot_red.gif

<TABLE cellSpacing=0 cellPadding=5 width=600 border=0><TBODY><TR><TD class=fbody colSpan=2>
Kindergartens in Chinese city ordered shut amid viral epidemic​
All kindergartens in Fuyang City in east China's Anhui Province were ordered to remain closed following the May Day holiday, which ended on Saturday.

The decision was taken by the Fuyang City Headquarters for prevention and control of the intestinal virus enterovirus 71, also known as EV71.

Kindergartens began their holiday last Monday, three days ahead of the national May Day holiday. A date for re-opening will be announced later, according to the announcement of closure.

Experts said the move would help prevent EV71 from spreading further.

EV71 can cause hand, foot and mouth disease, which usually starts with a slight fever followed by blisters and ulcers in the mouth and rashes on the hands and feet. There is no vaccine.

There has been a massive outbreak of EV71 in Fuyang, with 3,736 children sickened as of Friday. Of these, 22 have died and 12 were in critical condition. Some had brain, heart and lung damage.

All were aged below six, with the majority being under two.

Two other deaths from the lethal virus were reported in south China's Guangdong Province on Saturday evening.

So far, China has tallied 4,987 cases of hand-foot-mouth disease in the provinces of Anhui, Hubei and Shaanxi this year.

Source: Xinhua

http://english.people.com.cn/90001/90782/6403384.html
</TD></TR></TBODY></TABLE>
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

E China province reports 21 cases of hand-foot-mouth disease​
East China's Jiangxi Province has recorded 21 cases of hand-foot-mouth disease this year, but no deaths have been reported, local health authorities said Sunday.

Ten cases were caused by the intestinal virus enterovirus 71 (EV71), while the others were caused by the Coxsackie A16 virus, another kind of enterovirus, said a Jiangxi Provincial Disease Prevention and Control Center official.

The number of hand-foot-mouth disease cases was almost the same as last year. People should follow preventive measures but do not need to panic, the official said.

EV71 can cause hand, foot and mouth disease, which usually starts with a slight fever followed by blisters and ulcers in the mouth and rashes on the hands and feet.

Coxsackie A16 virus causes most cases of hand, foot and mouth syndrome. The major features are painful mouth ulcers and blisters on the palms, fingers and soles.

There has been a large outbreak of EV71 in Anhui Province, where the death toll in Fuyang city has risen to 22 since early March.

Two children have also died from the EV71 virus in south China's Guangdong Province, the provincial health department said on Saturday.

China has tallied 4,987 cases of hand, foot and mouth disease in the provinces of Anhui, Hubei and Shaanxi this year, most of which were confirmed to be caused by the EV 71 virus.

Source: Xinhua
http://english.people.com.cn/90001/90782/6403388.html
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Source: http://www.chinadaily.com.cn/china/2008-05/05/content_6660258.htm

Nationwide alert issued on disease
By Shan Juan and Wang Jingqiong (China Daily)
Updated: 2008-05-05 06:23

A nationwide alert has been issued in a bid to control a virus that has caused 22 deaths in one city and shows signs of spreading to other parts of the country.

The Ministry of Health warned on Saturday that cases of hand-foot-mouth disease (HFMD) will possibly increase in the following months since June and July are the peak seasons for the disease.

Following the 22 children's deaths reportedly caused by enterovirus 71, or EV71, in Fuyang of Anhui province, two other deaths from the same virus have been confirmed in Guangdong province, Xinhua News Agency reported yesterday.

By May 2, 4,529 HFMD cases had been reported in Anhui, including 3,736 cases in worst-hit Fuyang, the provincial health authority said yesterday. Of those in Fuyang, 22 have died and 12 are in critical condition, with more than 600 still in hospital. Some have damaged brains, hearts and lungs.

Several hundred cases have emerged in other places including Henan, Hubei, Shaanxi, Zhejiang, Jiangxi and Guangdong provinces as well as the Hong Kong and Macao special administrative regions.

EV71 has been confirmed to have caused some of the cases, Xinhua reported.

A high-level taskforce headed by Minister of Health Chen Zhu has been set up to curb the spread of the highly contagious disease following the outbreak of EV71.

"Local Party and government officials are on high alert. The authorities are taking urgent measures to prevent the disease and speed up treatment," the ministry said in a statement.

It said special equipment was being installed in children's wards; and the local authorities were strengthening checks on food and water safety to stop the disease from spreading.

HFMD, characterized by fever, sores in the mouth and rashes on hands and feet, is not a new infection and is common among infants and children, experts say. It can be triggered by various viruses and usually does not lead to death.

Of the fatal cases reported this year, severe complications due to EV71 infection including meningitis, encephalitis, pulmonary edema and paralysis were the cause of death.

"While not all the children infected with the virus develop the lethal complications, prevention and early diagnosis and treatment are crucial for recovery" said Liu Xiaolin, a leading doctor at Fuyang No 2 People's Hospital, which has been designated for treatment of the disease.

The MOH said on its website that "HFMD is highly preventable and can be treated".

However, there is no effective vaccine available worldwide to kill the EV71 and "current medical intervention targets the complications from the viral infection", Liu noted.

Under such circumstances, prevention should be a priority, said Liu Qian, vice-minister of health, who heads an expert team in Fuyang.

The ministry issued a circular on Friday requiring hospitals to report the disease within 24 hours, and told local health departments to publicize emergency information and the epidemic situation.

"The move is important for more timely reports and would facilitate research," said a researcher surnamed Ning at the center for disease prevention and control of Fuyang.

To relieve the economic burden on patients, the Fuyang government is set to provide highly subsidized, or even free, treatment.

"Most of the infected children in Fuyang are from the poor countryside," Liu noted. A 10-day hospitalization typically costs 10,000 yuan ($1,420), she added.

The ministry also vowed more training on HFMD diagnosis and treatment for pediatricians across the country.
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Source: http://www.cctv.com/english/20080505/101732.shtml

EV71 death rate falls in Fuyang
Source: CCTV.com | 05-05-2008 09:29

The emergency medical team sent to the Fuyang, Anhui province by the Health Ministry says quick and correct treatment in the last two weeks has greatly reduced the death rate among young children with the disease. The team has been giving local doctors special training to deal with the disease.

22 children have now died from the EV71 virus. In the past two weeks, 5 of the 36 severely ill died, but most of the others are in a stable condition.
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

EV71疫情持续扩大​
EV71 epidemic continues to expand
星岛环球网www.stnn.cc
Sing Tao Global Network www.stnn.cc
<STYLE id=_Custom_Style_>.h1 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 22pt; MARGIN: 17pt 0cm 16.5pt; LINE-HEIGHT: 240%; TEXT-ALIGN: justify}.h2 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 16pt; MARGIN: 13pt 0cm; LINE-HEIGHT: 173%; TEXT-ALIGN: justify}.h3 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 16pt; MARGIN: 13pt 0cm; LINE-HEIGHT: 173%; TEXT-ALIGN: justify}DIV.union { FONT-SIZE: 14px; LINE-HEIGHT: 18px}DIV.union TD { FONT-SIZE: 14px; LINE-HEIGHT: 18px}.h1 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 22pt; MARGIN: 17pt 0cm 16.5pt; LINE-HEIGHT: 240%; TEXT-ALIGN: justify}.h2 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 16pt; MARGIN: 13pt 0cm; LINE-HEIGHT: 173%; TEXT-ALIGN: justify}.h3 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 16pt; MARGIN: 13pt 0cm; LINE-HEIGHT: 173%; TEXT-ALIGN: justify}.union { FONT-SIZE: 14px; LINE-HEIGHT: 18px}.union TD { FONT-SIZE: 14px; LINE-HEIGHT: 18px}</STYLE>
W020080505315862972845.jpg

肠道疾病EV71短短一个月内攻陷整个北半球,中国的疫情更由安徽蔓延至浙江杭州、湖北、陕西及广东佛山。​
Gastro-intestinal diseases EV71 fall within a short span of a month throughout the northern hemisphere, and China's more from the epidemic spread to Hangzhou, Zhejiang, Anhui, Hubei, Shaanxi and Guangdong Foshan.​

W020080505315870854599.jpg
截至5月2日,阜阳累计报告手足口病3736例,其中痊愈1460例,死亡22例,重症30例,病危12例。​
As of May 2, Fuyang had reported 3,736 cases of Hand, Foot and mouth disease, which recovered 1,460 cases, 22 cases of death, 30 cases of severe, 12 cases of illness. :tiphat: http://64.233.179.104/translate_c?h...w.stnn.cc/toppic/200805/t20080505_773606.html
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Jiangsu found three cases of EV71 infections from two cases in Chuzhou, Anhui
2008-05-05 07:34:44 copy paper addresses passed on QQ / MSN online friends
大字 中字 小字 】【 打印 】【 发表评论 】​
[Read the word Koaza] [Print] comment:
<STYLE id=_Custom_Style_>.h1 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 22pt; MARGIN: 17pt 0cm 16.5pt; LINE-HEIGHT: 240%; TEXT-ALIGN: justify}.h2 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 16pt; MARGIN: 13pt 0cm; LINE-HEIGHT: 173%; TEXT-ALIGN: justify}.h3 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 16pt; MARGIN: 13pt 0cm; LINE-HEIGHT: 173%; TEXT-ALIGN: justify}DIV.union { FONT-SIZE: 14px; LINE-HEIGHT: 18px}DIV.union TD { FONT-SIZE: 14px; LINE-HEIGHT: 18px}.h1 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 22pt; MARGIN: 17pt 0cm 16.5pt; LINE-HEIGHT: 240%; TEXT-ALIGN: justify}.h2 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 16pt; MARGIN: 13pt 0cm; LINE-HEIGHT: 173%; TEXT-ALIGN: justify}.h3 { FONT-WEIGHT: bold; TEXT-JUSTIFY: inter-ideograph; FONT-SIZE: 16pt; MARGIN: 13pt 0cm; LINE-HEIGHT: 173%; TEXT-ALIGN: justify}.union { FONT-SIZE: 14px; LINE-HEIGHT: 18px}.union TD { FONT-SIZE: 14px; LINE-HEIGHT: 18px}</STYLE>
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

<TABLE cellSpacing=0 cellPadding=0 width=830 border=0><TBODY><TR><TD width=830 colSpan=4>Monday, May 5, 2008



</TD></TR><TR><TD width=830 colSpan=4>WHO: virus that killed 24 children not a threat to Games



</TD></TR><TR><TD vAlign=top width=520>By Henry Sanderson, AP



BEIJING -- A highly infectious virus that has killed 24 children in China is unlikely to be a threat to the Beijing Olympics, although it is too early to tell whether it has peaked, the World Health Organization said Sunday.
<SCRIPT type=text/javascript><!--google_ad_client = "pub-7534774113194702";google_ad_width = "300";google_ad_height = "250";google_ad_format = "300x250_as";google_ad_type = "text_image";//2007-07-08: 300x250_FullStory_Topgoogle_ad_channel = "5439847224";google_color_border = "FFFFFF";google_color_bg = "FFFFFF";google_color_link = "0000FF";google_color_text = "000000";google_color_url = "0000FF";//--></SCRIPT><SCRIPT src="http://pagead2.googlesyndication.com/pagead/show_ads.js" type=text/javascript></SCRIPT>

The death toll from the virus, which mostly sickens children, rose to 24 Sunday as two more deaths were reported in a new province amid heightened efforts by China's Health Ministry to contain it.
The outbreak of enterovirus 71 -- which causes a severe type of hand, foot and mouth disease -- is another headache for the Communist government as it prepares for the Olympic Games, already tarnished by unrest among Tibetans in western China and an international torch relay disrupted by protests.
"I don't see it at all as a threat to the Olympics or any upcoming events. ... This is a disease mainly affecting young children," WHO China representative Hans Troedsson told a news conference.
Troedsson said the virus normally peaks in June and July so these outbreaks were earlier than normal, meaning there could still be an increase in infections as the weather warms up. The disease thrives in hot climates, and Asia has seen increased occurrences in recent years, including in Singapore, Vietnam and Taiwan, he said.
The official Xinhua News Agency said an 18-month-old boy who died in Foshan city in Guangdong province Friday had the enterovirus 71 virus, also known as EV-71. Another child who died in the same district on April 25 also tested positive, it said.
The deaths follow 22 already reported in central Anhui province, 1,700 kilometers (1,000 miles) to the north.
The virus in all cases was the same subtype, so there was no evidence that it had changed to a more deadlier version and had probably come from different sources rather than spread, Troedsson said. "What we have seen so far is no connection between or among these different outbreaks," he said.
</TD></TR></TBODY></TABLE>
:tiphat: http://www.chinapost.com.tw/china/national news/2008/05/05/154922/WHO:-virus.htm
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Excerpt:

Child death toll rises to 26 in China virus outbreak
Posted: 05 May 2008 1529 hrs

BEIJING : The death toll in China from a virus that preys on children rose to 26 on Monday with state-run media reporting another victim, as the government pressed on with efforts to rein in the outbreak.

The death occurred in eastern China's Zhejiang province, the state-run Zhejiang Online news site said, without specifying when the person died.

http://www.channelnewsasia.com/stories/afp_asiapacific/view/345636/1/.html
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Hand-foot-mouth epidemic still continues to spread across China
2008-05-05 16:39:45
BEIJING, May 5 (Xinhua) --

The number of Chinese children infected with hand-foot-mouth disease (HFMD) continues to rise, with reported cases exceeding 8,531 on Monday.

All were aged below six, with the majority being under two.

Altogether 25 children have died of the disease.

Tests have confirmed 24 of the deaths were triggered by the virus known as enterovirus 71 or EV71.

According to the Guidelines Regarding Prevention and Control of HFMD published on the Ministry of Health website, HFMD can be caused by a host of intestinal viruses, but EV71 and the Coxsackievirus (Cox A 16) were the most common.

Anhui Province, in east China, and Guangdong Province, south China were the worst hit areas.

Twenty-two of the deaths occurred in Fuyang, a city in northwestern Anhui, and the rest happened in Guangdong.

The two regions were followed by Beijing, Jiangsu, Hunan and Hubei, according to statistics released by local health departments.

In Anhui alone, 622 new cases were reported on Saturday, including 362 in Fuyang, driving up the number of children with HFMD to 5,151 in Anhui.

Beijing has recorded at least 1,010 cases of the disease, while Guangdong registered 925 cases as of Sunday.

Both EV71 and Cox A16 can cause HFMD, which usually starts witha slight fever followed by blisters and ulcers in the mouth and rashes on the hands and feet.

Those sickened by EV71 often show serious symptoms. It can also lead to meningitis, encephalitis, pulmonary edema and paralysis in some children. There is no vaccine.

Saying reports of HFMD could increase in the next few months, the Health Ministry issued a circular late last month requiring better management and surveillance of the disease.

The ministry asked hospitals for daily reports on the disease, and for local health departments to report emergencies promptly and increase investment in research into the disease.


Editor: Du Guodong
-
http://rss.xinhuanet.com/newsc/english/2008-05/05/content_8109572.htm
------
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Out of Indo:

The plague of the Illness in China, the Department of Health not yet will issue Travel Warning

Related increasingly spread him the case enterovirus 71 disejumlah the ASEAN country, the Department's side of the Health (the Department of Health) stressed at the moment, the Indonesian government not yet would dismissed travel warning (the ban berpergian) so that the Indonesian resident or the other affected country did not visit each other.
"We (the Department of Health), continued to monitor KLB that happened in China.
Indonesia also has mengkonsultasikan this with WHO (the organisation of the health of the world).
Till this second, WHO did not yet categorise this virus as international concern
," firm Director Pengendalian of infectious diseases of Langsung Department of Health Chandra Yoga Adhitama in Jakarta, on Monday (5/5).

Chandra stressed, every time emerged the plague of the new illness, generally each country would mengkonsultasikan him with WHO. Lantaran WHO did not yet categorise the virus as international concern and did not give the suggestion anything, then the Indonesian government till at this time did not yet carry out the policy of the banning anything related this problem.

However, added Chandra, the Department of Health at this time still was continuing to monitor the development of the plague that happened disejumlah this country.
"Data concerning this illness, still was continuing to be gathered by us," he said.
Moreover, his side at this time also still was continuing to wait the development news tentnag this illness from WHO.
Touched on, is there this possibility the new illness kind, Chandra commented, the illness as a result of being infected enterovirus not something that was new in the medical world.


Generally disetiap the country was met by this, only that distinguished was the level of the ferocity.
Concerning the incident in China, himself claimed, could not give the comment more detailed, the reason, the information collection that could be taken was still being minimal.

Beforehand, be based on from few information collections that could be received, the internal disease expert from the Department of Knowledge of Penyakit Dalam FKUI-RSCM Ari Fahrial Syam hypothesised, the plague that happened in China apparently only illnesses that were local.
His article, the spread of the illness, was only spread through the food media and the waste.

Was different from the case of bird flu that his distribution through air, so as the range of his spread of enough areas.
Whereas when the spread media through food, will have difficulty could spread to the other area, moreover the country's passage.
"Virus that was flattest to food, generally dies when being brought to the other country with the different climate," he stated.


-snip-
http://www.mediaindonesia.com/berita.asp?id=168872
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

China punishes doctors, officials for misdeeds in foot-hand-mouth epidemic

2008-05-05 21:57:33

HEFEI, May 5 (Xinhua) --

Authorities in east China's Anhui province have ordered punishment for 10 doctors and officials for their misdeeds in handling the hand-foot-mouth disease that has caused 22 deaths in the province, official sources said on Monday.

Song Yunxin and Li Guangming, both doctors with the Shaoying Town Hospital in Fuyang city were given demerits on Saturday by the Yingquan district health bureau for delaying shifting a patient to the county hospital.

The patient came to the hospital on April 30 and May 1 for fever and vomiting. Song and Li just gave intravenous drips to the patient without proper examination, nor did they refer the patient to other hospitals.

Later on May 1, when the same patient came to the hospital of Xingliu township. The case was diagnosed as meningitis by Liu Jiajun, vice director of the hospital. And it was not until 9:00 p.m. on the same day that the patient was shifted to another hospital.

Wang Dongjun, a Lichen village doctor in Santa town, Taihe county, was fined 4,080 yuan (583 U.S. dollars) for illegally injecting immune globulin on 17 children.

Wang trumpeted that his immune globulin could prevent the EV71 intestinal virus, which is one of the causes of hand-foot-mouth disease. He charges 80 yuan for each injection.

Li Baohua, a Zhanxi village doctor in Santang town was also punished for the same reason.

Li Peixun and four other officials were reprimanded by the government of Taihe county for failing their duties in spreading knowledge about the disease in Lichen village, where they were posted.
The government said this had made it possible for doctor Wang to profiteer from the disease.

Both EV71 and Cox A16 can cause HFMD, which usually starts with a slight fever followed by blisters and ulcers in the mouth and rashes on the hands and feet.

Those sickened by EV71 often show serious symptoms. It can also lead to meningitis, encephalitis, pulmonary edema and paralysis in some children. There is no vaccine.

The number of Chinese children infected with hand-foot-mouth disease (HFMD) continues to rise Monday, with reported cases exceeding 8,531, according to Xinhua counting of local official results.


Editor: Feng Tao
-
http://rss.xinhuanet.com/newsc/english/2008-05/05/content_8111017.htm
-------
 
Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Re: China: EV-71 outbreak Kills 22 children in Fuyang City

Chinese province reports 1,198 hand-foot-mouth cases
2008-05-05 22:52:23

HANGZHOU, May 5 (Xinhua) --
Zhejiang Province in east China has recorded 1,198 cases of hand-foot-mouth disease (HFMD), including one death, this year, the provincial health department said on Monday.

A five-year-old boy died of the epidemic triggered by the intestinal virus known as EV71 in Wenzhou city on April 6 when medical efforts failed.

Another eight HFMD cases were also tested positive for EV71, a highly contagious virus that preys on children usually aged between two and six.

The rest of the registered cases were possibly caused by Cox A 16 or Echo virus, according to Lin Junfen, an expert with the provincial center for disease control and prevention.

Zhejiang has witnessed an increasing number of HFMD cases in recent years.

It reported 101 cases in 2005, 793 cases in 2006 and 1,607 cases in 2007, said Zhao Feng, an official with the health department.

A medical emergency reporting mechanism has been established in the province to closely track suspected cases, and local authorities have been reminding people of paying more attention to sanitation.

Altogether 26 children have died of the disease across the nation, with 22 registered in Anhui Province and three in Guangdong Province. Tests have confirmed 25 of the deaths were triggered by EV71.


Editor: Yan Liang
-
http://rss.xinhuanet.com/newsc/english/2008-05/05/content_8111164.htm
-----
 
Back
Top Bottom