• FluTrackers.com Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster. The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website. By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
  • We are not asking for any donations. Do not donate to any entity who says they are raising funds for us.

H5N1 returns to Germany

Re: H5N1 returns to Germany

Source: http://de.indymedia.org/2008/10/229827.shtml
Google translation:

Third case of "bird flu" in Saxony
Werner Hupperich 18.10.2008 13:07 Topics: biopolitics

There were apparently already on 02 October for further infection cases of "bird flu" in Saxony, on which the public, however, was not informed.
Third case of "bird flu" in Saxony - the public was not informed

As the OIE report (Ref OIE 7439), 17 October to show that there was apparently already on 02 October for further infection cases in Saxony. For a Stadtgut M?lkau located near Leipzig poultry livestock were influenza virus type H5 demonstrated. According to the OIE report were the 106 animals in the poultry immediately after detection of the virus killed. According to the OIE is the exact determination of the neuraminidase from the Friedrich-Loeffler-Institute until today. Whether it's the same, low-pathogenic H5N3 virus is, as he seems simultaneously in Leipzig in four zoo animals, is currently uncertain. Is also unclear why the public in case of outbreak in Stadtgut M?lkau despite 106 affected animals was not promptly informed. Werner Hupperich / WAI

V.d.i.S.d.P.:

Werner Hupperich
WAI - Science Forum avian influenza

Gottliebstra?e 57
47166 Duisburg

E-mail: werner.hupperich @ wai.netzwerk-phoenix.net

Internet: www.wai.netzwerk-phoenix.net
 
Re: H5N1 returns to Germany

Virus could quickly spread worldwide
Lower Saxony has for 12 percent of the population against bird flu - Large businesses before


Von Cornelia Steiner​
By Cornelia Steiner
<!-- author -->

http://209.85.171.104/translate_c?h...306653&usg=ALkJrhgfqW9UkEqcMYy4DjEu1xf9vnzrSg BRUNSWICK. For chickens, ducks and geese had in the past two years repeatedly kept indoors. This should prevent migratory birds which domestic poultry with the bird flu virus infect. This year there were poultry nationwide only one case of bird flu, also called avian influenza. A stall duty has not been prescribed.


Why the virus can be dangerous for humans?
Bird flu spreads from Asia coming from. So far, only the virus from animal to animal or from animals to humans. Flu viruses change constantly, however. Doctors fear so that it eventually mutate and among humans could spread.
"The virus would then have immediate global importance because, for example through coughing or sneezing is transmitted and thus spreads very quickly," says Rudi Balling, director of the Helmholtz Center for Infection Research in Brunswick.
The sudden outbreak of infectious disease SARS in 2003 has shown how quickly a pathogen can occur worldwide. The origin lay in Southeast Asia, but shortly afterwards were also infected people in Canada - the lung virus was on the plane mitgereist. Around 900 people have died worldwide at that time.

How can we protect ourselves?
"We must be proactive and take measures without panic, and everyone in his field," says Rudi Balling. To build the Helmholtz Institute with the Hanover Medical School Department of Virology at.
Braunschweiger researchers also will cooperate with the bird flu virus deal.
The provinces also provide before. They have stocks of flu Tamiflu and Relenza funds created. The Robert Koch Institute recommends a stock for 20 percent of the population. This could provide different scenarios that all patients be treated while until a vaccine is produced.
Lower Saxony has a stock for roughly 12 percent of the population.
"We rely on our screening system. The opportunity, thus the threat of a pandemic early to detect and combat is very high," says Christian Stichternath, spokesman for the Ministry of Social Affairs.
Public institutions and large corporations have also ordered medication. "Of course there is a pandemic in our planning, as in the usual big industry," said a Volkswagen spokesman. Details are not known.

Monday, 20.10.2008 :tiphat:http://www.newsclick.de/index.jsp/menuid/2046/artid/9306653
 
Re: H5N1 returns to Germany

http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=136054170

LOCUS AM403155 538 bp RNA linear VRL 18-MAR-2008
DEFINITION Influenza A virus (A/tufted duck/Germany/R1240/06(H5N1)) partial NA
gene for neuraminidase, genomic RNA.
ACCESSION AM403155
VERSION AM403155.1 GI:136054170
KEYWORDS NA gene; neuraminidase.
SOURCE Influenza A virus (A/tufted duck/Germany/R1240/06(H5N1))
ORGANISM Influenza A virus (A/tufted duck/Germany/R1240/06(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1
AUTHORS Starick,E., Beer,M., Hoffmann,B., Staubach,C., Werner,O.,
Globig,A., Strebelow,G., Grund,C., Durban,M., Conraths,F.J.,
Mettenleiter,T. and Harder,T.
TITLE Phylogenetic analyses of highly pathogenic avian influenza virus
isolates from Germany in 2006 and 2007 suggest at least three
separate introductions of H5N1 virus
JOURNAL Vet. Microbiol. 128 (3-4), 243-252 (2008)
PUBMED 18031958
REFERENCE 2 (bases 1 to 538)
AUTHORS Starick,E.
TITLE Direct Submission
JOURNAL Submitted (19-SEP-2006) Starick E., Fed. Res. Inst. for Animal
Health, Fr.-Loeffler-Institut, Boddenblick 5a, 17493
Greifswald-Insel Riems, GERMANY
FEATURES Location/Qualifiers
source 1..538
/organism="Influenza A virus (A/tufted
duck/Germany/R1240/06(H5N1))"
/virion
/mol_type="genomic RNA"
/strain="A/tufted duck/Germany/R1240/06"
/serotype="H5N1"
/db_xref="taxon:404928"
/country="Germany"
gene <1..>538
/gene="NA"
CDS <1..>538
/gene="NA"
/codon_start=3
/product="neuraminidase"
/protein_id="CAL48246.1"
/db_xref="GI:136054171"
/db_xref="GOA:A4H1V7"
/db_xref="InterPro:IPR001860"
/db_xref="UniProtKB/TrEMBL:A4H1V7"
/translation="WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC
VNGSCFTVMTDGPSSGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYPDAGEITCV
CRDNWHGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGVKGF
SFKYGNGVWIGRTKSTNS"
ORIGIN
1 gttggttgac aattggaatt tctggtccag ataatggggc tgtggctgta ttgaaataca
61 atggcataat aacagacacc atcaagagtt ggaggaacaa catactgaga actcaagagt
121 ctgaatgtgc atgtgtaaat ggctcttgct ttactgtaat gactgatgga ccaagtagtg
181 ggcaggcatc atataagatc ttcaaaatgg aaaaaggaaa agtggttaaa tcagtcgaat
241 tggatgctcc taattatcac tatgaggagt gctcctgtta tcctgatgcc ggcgaaatca
301 catgtgtgtg cagggataat tggcatggct caaataggcc atgggtatct ttcaatcaaa
361 atttggagta tcaaatagga tatatatgca gtggagtttt cggagacaat ccacgcccca
421 atgatggaac aggtagttgt ggtccggtgt cccctaacgg ggcatatggg gtaaaagggt
481 tttcatttaa atacggcaat ggtgtttgga tcgggaggac caaaagcact aattccag
 
Re: H5N1 returns to Germany

G743A update

gb|FJ222317.1| Influenza A virus (A/duck/Egypt/R5/2007(H5N1))... 46.1 0.001
gb|FJ222299.1| Influenza A virus (A/chicken/Egypt/R2/2007(H5N... 46.1 0.001
gb|FJ183473.1| Influenza A virus (A/mallard/Bavaria/10/2007(H... 46.1 0.001
gb|EU814505.1| Influenza A virus (A/rook/Rostov-on-Don/26/200... 46.1 0.001
gb|EU812566.1| Influenza A virus (A/swine/Tabanan-Indonesia/0... 46.1 0.001
gb|EU700510.1| Influenza A virus (A/saker falcon/Kuwait/0286/... 46.1 0.001
gb|EU717858.1| Influenza A virus (A/chicken/Egypt/1709-6/2008... 46.1 0.001
gb|EU616826.1| Influenza A virus (A/moorhen/Thailand/CU-317/0... 46.1 0.001
gb|EU616830.1| Influenza A virus (A/watercock/Thailand/CU-319... 46.1 0.001
gb|EU616832.1| Influenza A virus (A/quail/Thailand/CU-320/06(... 46.1 0.001
gb|EU616834.1| Influenza A virus (A/chicken/Thailand/CU-321/0... 46.1 0.001
gb|EU650487.1| Influenza A virus (A/falcon/Saudi Arabia/6732-... 46.1 0.001
gb|EF553332.1| Influenza A virus (A/chicken/Anhui/T5/2006(H5N... 46.1 0.001
gb|EU434688.1| Influenza A virus (A/Jiangsu/1/2007(H5N1)) neu... 46.1 0.001
gb|EU434696.1| Influenza A virus (A/Jiangsu/2/2007(H5N1)) neu... 46.1 0.001
gb|EU443570.1| Influenza A virus (A/Cygnus olor/Czech Republi... 46.1 0.001
gb|EU443569.1| Influenza A virus (A/chicken/Czech Republic/11... 46.1 0.001
gb|EU443568.1| Influenza A virus (A/turkey/Czech Republic/103... 46.1 0.001
gb|EU445682.1| Influenza A virus (A/houbara bustard/Saudi Ara... 46.1 0.001
gb|CY029400.1| Influenza A virus (A/chicken/Yunnan/1628/2003(... 46.1 0.001
gb|CY029337.1| Influenza A virus (A/duck/Yunnan/971/2002(H5N1... 46.1 0.001
gb|CY029330.1| Influenza A virus (A/duck/Yunnan/862/2002(H5N1... 46.1 0.001
gb|CY029162.1| Influenza A virus (A/quail/Shantou/3071/2002(H... 46.1 0.001
gb|CY029155.1| Influenza A virus (A/quail/Shantou/3054/2002(H... 46.1 0.001
gb|EU441936.1| Influenza A virus (A/pigeon/Rostov-on-Don/6/20... 46.1 0.001
gb|EU441928.1| Influenza A virus (A/muscovy duck/Rostov-on-Do... 46.1 0.001
gb|EU486854.1| Influenza A virus (A/starling/Rostov-on-Don/39... 46.1 0.001
gb|CY029998.1| Influenza A virus (A/chicken/Kuwait/KISR9/2007... 46.1 0.001
gb|CY029990.1| Influenza A virus (A/chicken/Kuwait/KISR8/2007... 46.1 0.001
gb|CY029982.1| Influenza A virus (A/chicken/Kuwait/KISR7/2007... 46.1 0.001
gb|CY029974.1| Influenza A virus (A/chicken/Kuwait/KISR6/2007... 46.1 0.001
gb|CY029966.1| Influenza A virus (A/chicken/Kuwait/KISR5/2007... 46.1 0.001
gb|CY029958.1| Influenza A virus (A/chicken/Kuwait/KISR3/2007... 46.1 0.001
gb|CY029950.1| Influenza A virus (A/chicken/Kuwait/KISR2/2007... 46.1 0.001
gb|EU429763.1| Influenza A virus (A/duck/Eastern China/51/200... 46.1 0.001
gb|EU429757.1| Influenza A virus (A/duck/Eastern China/40/200... 46.1 0.001
gb|EU401753.1| Influenza A virus (A/chicken/Rostov-on-Don/35/... 46.1 0.001
emb|AM498624.1| Influenza A virus (A/mute swan/France/06631a/... 46.1 0.001
emb|AM498622.1| Influenza A virus (A/greylag goose/France/063... 46.1 0.001
emb|AM498618.1| Influenza A virus (A/turkey/France/06222-1.1/... 46.1 0.001
gb|EF395821.1| Influenza A virus (A/mute swan/France/06299/20... 46.1 0.001
gb|EU148422.1| Influenza A virus (A/chicken/Nigeria/1071-22/2... 46.1 0.001
gb|EU148406.1| Influenza A virus (A/chicken/Nigeria/1071-10/2... 46.1 0.001
emb|AM749444.1| Influenza A virus (A/mute swan/Germany/R1359/... 46.1 0.001
gb|EU257632.1| Influenza A virus (A/Cygnus cygnus/Krasnodar/3... 46.1 0.001
gb|EF112344.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112343.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112342.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112341.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112340.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112339.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112338.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112337.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112336.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112334.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112333.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112332.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112331.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112330.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112329.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112328.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112327.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112326.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112325.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112324.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112323.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112322.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112321.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112320.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EF112319.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
emb|AM773725.1| Influenza A virus (A/black-necked grebe/Germa... 46.1 0.001
emb|AM749445.1| Influenza A virus (A/mute swan/Germany/R1349/... 46.1 0.001
gb|EU152226.1| Influenza A virus (A/common pochard/Switzerlan... 46.1 0.001
gb|EU152225.1| Influenza A virus (A/common pochard/Switzerlan... 46.1 0.001
gb|EU152224.1| Influenza A virus (A/mallard/Switzerland/V558/... 46.1 0.001
gb|EU152223.1| Influenza A virus (A/common coot/Switzerland/V... 46.1 0.001
gb|EU152222.1| Influenza A virus (A/mallard/Switzerland/V537/... 46.1 0.001
gb|EU152221.1| Influenza A virus (A/common pochard/Switzerlan... 46.1 0.001
gb|EU152220.1| Influenza A virus (A/tufted duck/Switzerland/V... 46.1 0.001
gb|EU152219.1| Influenza A virus (A/duck/Switzerland/V487/200... 46.1 0.001
gb|EU152218.1| Influenza A virus (A/duck/Switzerland/V426/200... 46.1 0.001
gb|EU152217.1| Influenza A virus (A/duck/Switzerland/V389/200... 46.1 0.001
gb|EU152216.1| Influenza A virus (A/little grebe/Switzerland/... 46.1 0.001
gb|EU152215.1| Influenza A virus (A/mute swan/Switzerland/V68... 46.1 0.001
gb|EU146625.1| Influenza A virus (A/Indonesia/6/2005(H5N1)) s... 46.1 0.001
gb|EU163433.1| Influenza A virus (A/chicken/Krasnodar/300/07(... 46.1 0.001
gb|DQ990005.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|DQ989997.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|DQ989989.1| Influenza A virus (A/open-billed stork/Nakhons... 46.1 0.001
gb|EU124234.1| Influenza A virus (A/Chicken/Indonesia/Semeran... 46.1 0.001
gb|EU124229.1| Influenza A virus (A/Chicken/Indonesia/Kulon16... 46.1 0.001
gb|EU124228.1| Influenza A virus (A/Chicken/Indonesia/Gunung ... 46.1 0.001
gb|EU124227.1| Influenza A virus (A/Quail/Indonesia/Sleman163... 46.1 0.001
gb|EU124109.1| Influenza A virus (A/Chicken/Karo/BBPV1/2006(H... 46.1 0.001
gb|EF178533.1| Influenza A virus (A/tiger/Thailand/VSMU-23-CB... 46.1 0.001
gb|EF178507.1| Influenza A virus (A/tree sparrow/Thailand/VSM... 46.1 0.001
gb|EF624252.1| Influenza A virus (A/chicken/Ghana/3160-NAMRU3... 46.1 0.001
gb|EF624251.1| Influenza A virus (A/chicken/Ghana/3159-NAMRU3... 46.1 0.001
gb|EF624250.1| Influenza A virus (A/chicken/Ghana/3158-NAMRU3... 46.1 0.001
emb|AM262561.1| Influenza A virus (A/chicken/Nigeria/SO452/20... 46.1 0.001
gb|EF541464.1| Influenza A virus (A/chicken/Korea/es/2003(H5N... 46.1 0.001
gb|EF512562.1| Influenza A virus (A/Prachinburi/6231/2004(H5N... 46.1 0.001
emb|AM403155.1| Influenza A virus (A/tufted duck/Germany/R124... 46.1 0.001
emb|AM403153.1| Influenza A virus (A/great crested grebe/Germ... 46.1 0.001
emb|AM403151.1| Influenza A virus (A/eagle owl/Germany/R1166/... 46.1 0.001
emb|AM403149.1| Influenza A virus (A/falcon/Germany/R899/06(H... 46.1 0.001
emb|AM403148.1| Influenza A virus (A/gull/Germany/R882/06(H5N... 46.1 0.001
emb|AM403141.1| Influenza A virus (A/duck/Germany/R603/06(H5N... 46.1 0.001
emb|AM403140.1| Influenza A virus (A/duck/Germany/R592/06(H5N... 46.1 0.001
emb|AM403139.1| Influenza A virus (A/pochard/Germany/R348/06(... 46.1 0.001
gb|EF486246.1| Influenza A virus (A/chicken/Egypt/1892N3-HK49... 46.1 0.001
gb|EF486245.1| Influenza A virus (A/chicken/Egypt/1891N3-CLEV... 46.1 0.001
gb|EF486244.1| Influenza A virus (A/chicken/Egypt/1890N3-HK45... 46.1 0.001
gb|EF447431.1| Influenza A virus (A/chicken/Russia_Moscow obl... 46.1 0.001
gb|EF474448.1| Influenza A virus (A/chicken/Moscow/2/2007(H5N... 46.1 0.001
gb|EF473078.1| Influenza A virus (A/chicken/Cambodia/022LC3b/... 46.1 0.001
gb|EF473077.1| Influenza A virus (A/chicken/Cambodia/022LC2b/... 46.1 0.001
gb|EF473067.1| Influenza A virus (A/goose/Cambodia/022b/2005(... 46.1 0.001
gb|DQ835315.1| Influenza A virus (A/China/GD01/2006(H5N1)) se... 46.1 0.001
gb|EF165587.1| Influenza A virus (A/swan/Bavaria/21/2006(H5N1... 46.1 0.001
gb|EF165586.1| Influenza A virus (A/goosander/Bavaria/20/2006... 46.1 0.001
gb|EF165585.1| Influenza A virus (A/goldeneye duck/Bavaria/19... 46.1 0.001
gb|EF165584.1| Influenza A virus (A/goosander/Bavaria/18/2006... 46.1 0.001
gb|EF165583.1| Influenza A virus (A/swan/Bavaria/17/2006(H5N1... 46.1 0.001
gb|EF165582.1| Influenza A virus (A/swan/Bavaria/16/2006(H5N1... 46.1 0.001
gb|EF165581.1| Influenza A virus (A/falcon/Bavaria/15/2006(H5... 46.1 0.001
gb|EF165580.1| Influenza A virus (A/swan/Bavaria/14/2006(H5N1... 46.1 0.001
gb|EF165579.1| Influenza A virus (A/buzzard/Bavaria/13/2006(H... 46.1 0.001
gb|EF165577.1| Influenza A virus (A/common buzzard/Bavaria/11... 46.1 0.001
gb|EF165576.1| Influenza A virus (A/eagle owl/Bavaria/10/2006... 46.1 0.001
gb|EF165574.1| Influenza A virus (A/common pochard/Bavaria/7/... 46.1 0.001
gb|EF165573.1| Influenza A virus (A/swan/Bavaria/6/2006(H5N1)... 46.1 0.001
gb|EF165571.1| Influenza A virus (A/tufted duck/Bavaria/4/200... 46.1 0.001
gb|EF124296.1| Influenza A virus (A/goose/Yunnan/4804/2005(H5... 46.1 0.001
gb|EF124287.1| Influenza A virus (A/duck/Guangxi/4016/2005(H5... 46.1 0.001
gb|EF124275.1| Influenza A virus (A/duck/Guangxi/2775/2005(H5... 46.1 0.001
gb|EF124209.1| Influenza A virus (A/duck/Guangxi/89/2006(H5N1... 46.1 0.001
gb|DQ842490.1| Influenza A virus (A/Guangzhou/1/2006(H5N1)) n... 46.1 0.001
gb|EF057804.1| Synthetic construct neuraminidase (NA) gene, c... 46.1 0.001
gb|DQ884460.1| Influenza A virus (A/chicken/Vietnam/486A/2004... 46.1 0.001
gb|DQ530175.1| Influenza A Virus (A/dog/Thailand-Suphanburi/K... 46.1 0.001
gb|DQ493075.1| Influenza A virus (A/Vietnam/CL105/2005(H5N1))... 46.1 0.001
gb|DQ493056.1| Influenza A virus (A/goose/Vietnam/264/2004(H5... 46.1 0.001
gb|DQ493050.1| Influenza A virus (A/chicken/Vietnam/147/2004(... 46.1 0.001
gb|DQ493046.1| Influenza A virus (A/duck/Vietnam/286/2005(H5N... 46.1 0.001
gb|DQ493043.1| Influenza A virus (A/duck/Vietnam/S640/2005(H5... 46.1 0.001
gb|DQ493015.1| Influenza A virus (A/chicken/Dairi/BPPVI/2005(... 46.1 0.001
gb|DQ458993.1| Influenza A virus (A/mallard/Bavaria/1/2006(H5... 46.1 0.001
gb|AY553831.1| Influenza A virus (A/chicken/Thailand/Sukhotha... 46.1 0.001
gb|AY553822.1| Influenza A virus (A/duck/Thailand/Sukhothai-0... 46.1 0.001
gb|AY553819.1| Influenza A virus (A/chicken/Thailand/Uttaradi... 46.1 0.001
gb|AY553815.1| Influenza A virus (A/chicken/Thailand/Sukhotha... 46.1 0.001
gb|AY553813.1| Influenza A virus (A/chicken/Thailand/Nakornsa... 46.1 0.001
gb|AY553812.1| Influenza A virus (A/chicken/Thailand/Tak-01/2... 46.1 0.001
gb|DQ189242.1| Influenza A virus (A/chicken/Thailand/Kamphaen... 46.1 0.001
gb|DQ189241.1| Influenza A virus (A/chicken/Thailand/Kamphaen... 46.1 0.001
gb|DQ083618.1| Influenza A virus (A/chicken/Prachinburi/Thail... 46.1 0.001
gb|DQ083608.1| Influenza A virus (A/chicken/Saraburi/Thailand... 46.1 0.001
gb|DQ083607.1| Influenza A virus (A/rollers/Bangkok/Thailand/... 46.1 0.001
gb|DQ083606.1| Influenza A virus (A/crow/Bangkok/Thailand/CU-... 46.1 0.001
gb|DQ083605.1| Influenza A virus (A/chicken/Ayutthaya/Thailan... 46.1 0.001
gb|DQ096567.1| Influenza A virus (A/chicken/Malaysia/01/2004(... 46.1 0.001
gb|DQ321068.1| Influenza A virus (A/chicken/Vietnam/DT171/200... 46.1 0.001
gb|DQ321066.1| Influenza A virus (A/chicken/Malaysia/5858/200... 46.1 0.001
gb|DQ321059.1| Influenza A virus (A/chicken/Salatiga/BBVet-I/... 46.1 0.001
gb|DQ321047.1| Influenza A virus (A/goose/Shantou/2216/2005(H... 46.1 0.001
gb|DQ321045.1| Influenza A virus (A/duck/Hunan/1652/2005(H5N1... 46.1 0.001
gb|DQ321044.1| Influenza A virus (A/duck/Hunan/1608/2005(H5N1... 46.1 0.001
gb|DQ321043.1| Influenza A virus (A/duck/Hunan/1265/2005(H5N1... 46.1 0.001
gb|DQ321033.1| Influenza A virus (A/duck/Guangzhou/20/2005(H5... 46.1 0.001
gb|DQ321031.1| Influenza A virus (A/duck/Guangxi/793/2005(H5N... 46.1 0.001
gb|DQ321030.1| Influenza A virus (A/chicken/Guangxi/604/2005(... 46.1 0.001
gb|DQ321029.1| Influenza A virus (A/quail/Guangxi/575/2005(H5... 46.1 0.001
dbj|AB189063.1| Influenza A virus (A/crow/Osaka/102/2004(H5N1... 46.1 0.001
gb|AY651455.1| Influenza A virus (A/Ck/Viet Nam/C57/2004(H5N1... 46.1 0.001
gb|AY609314.1| Influenza A virus (A/chicken/Guangdong/174/04(... 46.1 0.001
gb|DQ017345.1| Influenza A virus (A/chicken/Uthaithani-2-03/2... 46.1 0.001
gb|DQ017344.1| Influenza A virus (A/chicken/Uthaithani-2-02/2... 46.1 0.001
gb|DQ017343.1| Influenza A virus (A/duck/Uthaithani-2-01/2004... 46.1 0.001
gb|DQ017342.1| Influenza A virus (A/chicken/Phitsanulok-2-02/... 46.1 0.001
gb|DQ017341.1| Influenza A virus (A/chicken/Phitsanulok-2-01/... 46.1 0.001
gb|DQ017340.1| Influenza A virus (A/chicken/Kamphaengphet-2-0... 46.1 0.001
gb|DQ017339.1| Influenza A virus (A/chicken/Kamphaengphet-2-0... 46.1 0.001
gb|DQ017338.1| Influenza A virus (A/chicken/Nakornsawan-2-05/... 46.1 0.001
gb|DQ017337.1| Influenza A virus (A/chicken/Uthaithani-2-04/2... 46.1 0.001
gb|DQ017336.1| Influenza A virus (A/chicken/Phetchabun-2-01/2... 46.1 0.001
gb|DQ017335.1| Influenza A virus (A/chicken/Kamphaengphet-2-0... 46.1 0.001
gb|DQ017334.1| Influenza A virus (A/chicken/Phitsanulok-2-04/... 46.1 0.001
gb|DQ017333.1| Influenza A virus (A/chicken/Nakornsawan-2-01/... 46.1 0.001
gb|DQ017332.1| Influenza A virus (A/chicken/Uthaithani-2-01/2... 46.1 0.001
gb|DQ017331.1| Influenza A virus (A/duck/Phitsanulok-2-01/200... 46.1 0.001
gb|DQ017330.1| Influenza A virus (A/chicken/Kamphaengphet-2-0... 46.1 0.001
gb|DQ017329.1| Influenza A virus (A/chicken/Phetchabun-2-02/2... 46.1 0.001
gb|DQ017328.1| Influenza A virus (A/chicken/Nakornsawan-2-04/... 46.1 0.001
gb|DQ017326.1| Influenza A virus (A/duck/Phichit-2-02/2004(H5... 46.1 0.001
gb|AY972546.1| Influenza A virus (A/tiger/Thailand/CU-T8/04(H... 46.1 0.001
gb|AY972545.1| Influenza A virus (A/tiger/Thailand/CU-T6/04(H... 46.1 0.001
gb|AY972544.1| Influenza A virus (A/tiger/Thailand/CU-T5/04(H... 46.1 0.001
gb|AY972543.1| Influenza A virus (A/tiger/Thailand/CU-T4/04(H... 46.1 0.001
gb|AY866476.1| Influenza A virus (A/tiger/Thailand/CU-T7/2004... 46.1 0.001
gb|AY842936.1| Influenza A virus (A/tiger/Thailand/CU-T3/2004... 46.1 0.001
gb|AY770992.1| Influenza A virus (A/chicken/Ayutthaya/Thailan... 46.1 0.001
gb|AY676044.1| Influenza A virus (A/duck/Korea/ESD1/03(H5N1))... 46.1 0.001
gb|AY676043.1| Influenza A virus (A/chicken/Korea/ES/03(H5N1)... 46.1 0.001
gb|AY818142.1| Influenza A virus (A/chicken/Vietnam/C58/04(H5... 46.1 0.001
gb|DQ251795.1| Influenza A virus (A/chicken/Thailand/Kamphaen... 46.1 0.001
gb|DQ251794.1| Influenza A virus (A/chicken/Thailand/Kamphaen... 46.1 0.001
 
Re: H5N1 returns to Germany

niman said:
Commentary

http://www.recombinomics.com/News/10200801/H5N1_Endemic_Saxony.html
Click to expand...
Commentary

Endemic H5N1 Confirmed in Saxony Germany
Recombinomics Commentary 15:20
October 20, 2008

8.10. confirmation AI H5N1 by national reference lab, sequencing ongoing ? first results indicated the presence of a HPAIV almost identical to the strain found in a tufted duck (Aythya fuligula) from the lake of Bautzen in 2006

The above comments from a report on the H5N1 and H5N3 outbreaks in Saxony strongly suggest that H5N1 is endemic in Germany and is circulating largely undetected. In 2006 there were three distinct sub-clades circulating in Germany, including one sub-clade which was also found in Switzerland, France, and the Czech Republic. Although this sub-clade was reported in multiple countries in early 2006, it has not been reported since. The recent detection of this sub-clade in 25 free range birds in Saxony indicates it has been circulating undetected in Germany for over 2 years.

Reports of H5N1 from Germany since the summer of 2007 have been limited to outbreak involving sub-clade 2.2.3, which is easily distinguished from the 2006 isolates in Germany.

However, in early 2007 clade 2.2.3 isolates began acquiring NA G743A, which had been limited to the 2006 isolates that included A/tufted duck/Germany/R1240/06. G743A was appended onto multiple clade 2.2 genetic backgrounds in early 2007, and clade 2.2.3 with G743A was widely detected in Europe after the summer 2007 outbreaks.

The detection of 2008 isolates with sequence closely related to the tuft duck isolate above suggests that this sub-clade may have been circulating undetected in late 2006 / early 2007 and may have been the donor sequence for the acquisition of G743A.

The detection of the 2006 sequence in 2008 strongly suggests that H5N1 is endemic in Germany and throughout Europe.


.
 
Re: H5N1 returns to Germany

Source: http://www.lvz-online.de/aktuell/content/76419.html

Google translation:

Bird flu at Gut M?lkau: All poultry flock killed

Leipzig. The bird flu has reached Stadtgut M?lkau. It is thus the Leipzig zoo after the second case in the fair city. The Veterinary Office confirmed that during a routine inspection in early October when three animals are low pathogenic influenza viruses were detected. Certainty have an investigation by the Friedrich-Loeffler-Institute on the island of Riems brought. Although it is less dangerous variant of the disease that had All 106 animals on the farm had been killed. "The legislature writes the way," said office manager Gabriela Leupold compared LVZ online. The inventory included 59 ducks, 17 geese, 24 chickens and 7 quails.

Has infected the poultry M?lkau probably in wild birds. They carry the H5 virus is often in and give it further. The experts are infected Hoftiere that although clinically healthy and showed no disease characteristics. The danger exists but is that the virus pathogenic type H5N1 to mutate. These variant of avian flu can also be dangerous for humans and lead to death.

According to a report to the Federal Ministry of Food, Agriculture and Consumer Protection, the LVZ online exists, is the case of Stadtgut M?lkau since the 9th October known. Previously, he was for the people, however, kept under lock. "With the low pathogenic variant is no information requirement," said a spokesman for the Dresdner Social Ministry.

Authorities would only internally by the official veterinarian, a data chain ausgl?st by the National Directorate of the Ministry of State until the federal government to Berlin rich. The state economy ministry directs a spokeswoman that the messages from the authorities network "Animal News" in addition to the European Union.

The Leipzig veterinary office head Leupold looks through the second case within a few days with no increased risk for Leipzig's poultry farmers in the vicinity of the goods M?lkau are just a breeder. Its stock had long been investigated, without proof of influenza viruses.

In the last week of the Leipzig Zoo had indicated that his investment is also less dangerous type of bird flu occurred. A yellow-beak, a Sichelente and a Brandgans therefore had to be killed. Also here are wild animals as a suspected polluter.

All birds in the zoo must now begin for three weeks remain in the stall. Then again samples taken from 60 animals. "Are all the negative, can be transferred back to normalcy," said Stefan Barton, spokesman for the National Directorate of Leipzig. Zoodirektoren Joerg Junold asks for understanding that these precautionary measures because some birds that would otherwise live in open-air enclosures, such as ostriches, pelicans and several species of water birds Not be seen.

In marker near Goerlitz was about two weeks before even the most dangerous variant of the bird flu outbreak at a duck. Other cases, according to council late last week not reported. In a radius of 50 kilometers, however, there is a strict requirement to keep birds indoors. Of these, the county Goerlitz, as well as parts of the counties Bautzen and Saxon Switzerland-east affected. In this restricted zone is also an import and export ban on poultry products.

Matthias Roth, LVZ-Online/L.P./dpa
German

?
English

Translate
 
Re: H5N1 returns to Germany

http://www.flutrackers.com/forum/showthread.php?t=26035

26.04.2006 SN Bautzen Bautzen (Neumalsitz) Wildente
34 > A/tufted duck/Germany/R1240/06

3 strains in Germany 2006:
(1)Baltic
(2)Bavaria (edit: also Switzerland,Czech,France)
(3)Italy/Slowakia/Austria/Czech/Slovenia

the tufted duck if drom (2) although Saxony, not Bavaria and close to the current location.
 
Re: H5N1 returns to Germany

gsgs said:
http://www.flutrackers.com/forum/showthread.php?t=26035

26.04.2006 SN Bautzen Bautzen (Neumalsitz) Wildente
34 > A/tufted duck/Germany/R1240/06

3 strains in Germany 2006:
(1)Baltic
(2)Bavaria
(3)Italy/Slowakia/Austria/Czech/Slovenia

the tufted duck if drom (2) although Saxony, not Bavaria and close to the current location.
Click to expand...
The Bavaria sub-clade was in Switzerland, czech republic, and france in earlyy 2006. All had g743a.
 
Re: H5N1 returns to Germany

AVIAN INFLUENZA (107): GERMANY (SAXONY), HPAIV & LPAIV
******************************************************
A ProMED-mail post
<http://www.promedmail.org>
ProMED-mail is a program of the
International Society for Infectious Diseases
<http://www.isid.org>

Date: Wed 22 Oct 2008
From: Martin Beer <Martin.Beer@fli.bund.de>


Highly pathogenic avian influenza virus H5N1 has been detected in
clinically healthy ducks in a mixed poultry holding in Saxony,
Germany. 30 oropharyngeal swabs from geese and ducks had been sampled
for routine monitoring purposes. A single duck tested positive for
HPAIV H5N1, and the cleavage site sequence was confirmed as
GERRRKKR*GLF on 9 Oct 2008. Subsequently, 157 additional duck samples
were obtained and revealed a further 24 H5N1 positives, of which 9
had sufficient viral loads to be confirmed as HPAIV. All poultry were
culled. No more cases have been detected up to now in contact farms
or in wild bird samples obtained from this region.

Preliminary sequence and phylogenetic analysis of the HA gene from 4
duck samples gave evidence for a representative of a cluster 2.2
sublineage which had been detected in spring 2006 in Southern
Germany. In fact, a virus from a tufted duck (R1240/06; Starick et
al., 2008) found in 2006 40 km away from the present outbreak
location is very closely related. So far, there are no records for
the presence of viruses of this sublineage after May 2006 in Germany
and Europe. In summary, the data suggest a very recent introduction
of HPAIV H5N1 into this farm from an as yet unknown source.

In parallel, LPAIV H5 infections have been detected in waterfowl in
the zoo of Leipzig, Saxony and in a small mixed poultry holding near
Leipzig. These viruses turned out to be typical representatives of
Eurasian H5 LPAIV currently also detected in aquatic wild birds in
Germany. Poultry at the LPAIV-affected holdings had been culled as
well.

[Elke Starick (Senior Scientist, OIE and National Reference
Laboratory AI) Dr. Christian Grund (Deputy Head OIE and National
Reference Laboratory AI) Dr. Timm Harder (Head OIE and National
Reference Laboratory AI) Dr. Martin Beer (Head Institute of
Diagnostic Virology, Friedrich-Loeffler-Institut) Prof. Dr. Thomas C.
Mettenleiter (President, Friedrich-Loeffler-Institut)]

--
Communicated by:
Dr. Martin Beer
Head Institute of Diagnostic Virology
Friedrich-Loeffler-Institut
Am Suedufer 10
17493 Greifswald-Insel Riems
Germany
<Martin.Beer@fli.bund.de>

[see also:
Avian influenza (105): Germany (Saxony), LPNAI H5N3, Update 20081018.3303
Avian influenza (104): Germany (Saxony), OIE, LPNAI H5N3, RFI 20081018.3296]
...................................................arn/msp/jw
 
Re: H5N1 returns to Germany

Asymptomatic H5N1 in Germany Raises Surveillance Concerns
Recombinomics Commentary 12:55
October 27, 2008


A single duck tested positive for HPAIV H5N1, and the cleavage site sequence was confirmed as GERRRKKR*GLF on 9 Oct 2008. Subsequently,157 additional duck samples were obtained and revealed a further 24 H5N1 positives, of which 9 had sufficient viral loads to be confirmed as HPAIV.

Preliminary sequence and phylogenetic analysis of the HA gene from 4
duck samples gave evidence for a representative of a cluster 2.2
sublineage which had been detected in spring 2006 in Southern
Germany. In fact, a virus from a tufted duck (R1240/06; Starick et
al., 2008) found in 2006 40 km away from the present outbreak
location is very closely related.

The above comments on H5N1 in asymptomatic free range ducks in Saxony, Germany, leaves little doubt that the sub-clade has been maintained for two years in an undetected reservoir in Germany. This sub-clade was found in wild birds in southern Germany, Switzerland, the Czech Republic and France in early 2006. The sequence was readily distinguished fro other clade 2.2 sub-clades in Europe, by virtue of a number of polymorphisms, including NA G743A. However, after the outbreaks in early 2006, there were no reports of this sub-clade in poultry or wild birds.

Although it is possible that the sub-clade was maintained in domestic poultry, a wild bird reservoir is more likely because of the failure to detect this sub-clade during routine poultry testing between 2005-2008. As noted above, the infected birds were asymptomatic and most birds positive by PCR did not have sufficient levels of RNA to yield sequencing data, which again raises surveillance questions.

Detection of H5N1 in asymptomatic birds has been problematic. Almost all detection in Europe has been in dead or dying birds. These detection failures have been noted worldwide. A December, 2005 from a teal in Egypt yielded HA and NA sequence data for clade 2.2, but the sequence creation required multiple RNA extractions and virus was not isolated. However, the sequence was closely related to clade 2.2 from Austria, even though no EU country had acknowledged H5N1 infections in 2005. The first confirmed positives in the EU were in early 2006, once again supporting the view that surveillance approaches generally produce false negatives for live wild birds transporting and transmitting H5N1.

The failures have been confirmed in experimentally infected wild birds. These birds, when infected with lower levels of virus, yield H5N1 positive PCR in nasopharyngeal swabs when cloacal swabs are negative. Moreover, like the above data, most of the samples that were PCR positive failed to lead to virus isolation. Isolation was generally limited to a single 24 hour time frame several days after infection. Thus, experimental birds that are shedding H5N1 usually fail to yield virus, and most samples produce false negatives.

These false negatives have led to earlier pronouncements on the demise of H5N1 in wild birds. In June, 2007, wild birds in Europe was declared free of H5N1 based on negative data generated by a consortium of bird conservation groups collecting samples for FAO. Within minutes of this pronouncement, the Czech Republic reported in H5N1 in domestic poultry. This announcement was followed by detection of H5N1 in wild birds in the Czech Republic, Germany, and France. These isolates were clade 2.2.3, which were readily distinguished from the various clade 2.2 sub-clade reported in Europe in 2006. The strain had evolved over the summer of 2006 in Mongolia at Uvs Lake. The appearance throughout Europe in the summer of 2007, when long range migration was minimal, suggested this sub-clade had also entered Europe undetected in the 2006/2007 season, and was not reported until the summer of 2007. These outbreaks were followe3d by widespread detection of the Uvs Lake version of clade 2.2.3 in Europe in the 2007/2008 season.

Thus, current surveillance methods largely miss H5N1 in asymptomatic birds. The most recent data define a sub-clade circulating undetected in Europe between 2006 and 2008. These assays also failed to detect H5N1 in EU countries prior to early 2006, and also failed to detect the entry of clade 2.2.3 in late 2006, early 2007.

These detection failures remain a cause for concern.
 
Re: H5N1 returns to Germany

tufted duck (R1240/06; Starick et
al., 2008) found in 2006 40 km away from the present outbreak
location is very closely related.

> very closely related

ahh.
How very ? Just the number of differences, please.


There are 2.5 years between those


so "very", that we could assume the virus was frozen ?




in 1 or 2 years they might tell us.
 
Re: H5N1 returns to Germany

gsgs said:
tufted duck (R1240/06; Starick et
al., 2008) found in 2006 40 km away from the present outbreak
location is very closely related.

> very closely related

ahh.
How very ? Just the number of differences, please.


There are 2.5 years between those


so "very", that we could assume the virus was frozen ?




in 1 or 2 years they might tell us.
Click to expand...
Please. The "frozen" nonsense (with no support) is getting old.
 
Re: H5N1 returns to Germany

niman said:
Commentary

http://www.recombinomics.com/News/10270802/H5N1_Germany_False.html
Click to expand...
Commentary

Asymptomatic H5N1 in Germany Raises Surveillance Concerns
Recombinomics Commentary 12:55
October 27, 2008

A single duck tested positive for HPAIV H5N1, and the cleavage site sequence was confirmed as GERRRKKR*GLF on 9 Oct 2008. Subsequently,157 additional duck samples were obtained and revealed a further 24 H5N1 positives, of which 9 had sufficient viral loads to be confirmed as HPAIV.

Preliminary sequence and phylogenetic analysis of the HA gene from 4 duck samples gave evidence for a representative of a cluster 2.2 sublineage which had been detected in spring 2006 in Southern Germany. In fact, a virus from a tufted duck (R1240/06; Starick et al., 2008) found in 2006 40 km away from the present outbreak location is very closely related.

The above comments on H5N1 in asymptomatic free range ducks in Saxony, Germany, leaves little doubt that the sub-clade has been maintained for two years in an undetected reservoir in Germany. This sub-clade was found in wild birds in southern Germany, Switzerland, the Czech Republic and France in early 2006. The sequence was readily distinguished from other clade 2.2 sub-clades in Europe, by virtue of a number of polymorphisms, including NA G743A. However, after the outbreaks in early 2006, there were no reports of this sub-clade in poultry or wild birds.

Although it is possible that the sub-clade was maintained in domestic poultry, a wild bird reservoir is more likely because of the failure to detect this sub-clade during routine poultry testing between 2005-2008. As noted above, the infected birds were asymptomatic and most birds positive by PCR did not have sufficient levels of RNA to yield sequencing data, which again raises surveillance questions.

Detection of H5N1 in asymptomatic birds has been problematic. Almost all detection in Europe has been in dead or dying birds. These detection failures have been noted worldwide. A December, 2005 from a teal in Egypt yielded HA and NA sequence data for clade 2.2, but the sequence creation required multiple RNA extractions and virus was not isolated. However, the sequence was closely related to clade 2.2 from Austria, even though no EU country had acknowledged H5N1 infections in 2005. The first confirmed positives in the EU were in early 2006, once again supporting the view that surveillance approaches generally produce false negatives for live wild birds transporting and transmitting H5N1.

The failures have been confirmed in experimentally infected wild birds. These birds, when infected with lower levels of virus, yield H5N1 positive PCR in nasopharyngeal swabs when cloacal swabs are negative. Moreover, like the above data, most of the samples that were PCR positive failed to lead to virus isolation. Isolation was generally limited to a single 24 hour time frame several days after infection. Thus, experimental birds that are shedding H5N1 usually fail to yield virus, and most samples produce false negatives.

These false negatives have led to earlier pronouncements on the demise of H5N1 in wild birds. In June, 2007, wild birds in Europe was declared free of H5N1 based on negative data generated by a consortium of bird conservation groups collecting samples for FAO. Within minutes of this pronouncement, the Czech Republic reported in H5N1 in domestic poultry. This announcement was followed by detection of H5N1 in wild birds in the Czech Republic, Germany, and France. These isolates were clade 2.2.3, which were readily distinguished from the various clade 2.2 sub-clade reported in Europe in 2006. The strain had evolved over the summer of 2006 in Mongolia at Uvs Lake. The appearance throughout Europe in the summer of 2007, when long range migration was minimal, suggested this sub-clade had also entered Europe undetected in the 2006/2007 season, and was not reported until the summer of 2007. These outbreaks were followed by widespread detection of the Uvs Lake version of clade 2.2.3 in Europe in the 2007/2008 season.

Thus, current surveillance methods largely miss H5N1 in asymptomatic birds. The most recent data define a sub-clade circulating undetected in Europe between 2006 and 2008. These assays also failed to detect H5N1 in EU countries prior to early 2006, and also failed to detect the entry of clade 2.2.3 in late 2006, early 2007.

These detection failures remain a cause for concern.


.
 
Re: H5N1 returns to Germany

Source: http://www.lvz-online.de/aktuell/content/77963.html

Google translation:

New suspected bird flu: dead swan found near Goerlitz

Goerlitz / Dresden. A county in Goerlitz discovered dead swan is being tested for bird flu on. The bird was at the weekend near a sawmill in Dauban / Hohendubrau been found, told the council on Tuesday. In the Saxon Investigation Institute in Dresden, he will now concentrate on dangerous influenza virus type H5N1 investigated. "A dead swan is nothing extraordinary about this season, but we are aware," said a spokeswoman. The result would be expected shortly.

In early October was on a Gefl?gelhof marker in the village at Goerlitz outbreak of bird flu. First it was the only one duck was infected. According to the Ministry of Social Affairs in Dresden was the virus, but more than 20 other ducks from the collection have been demonstrated. Around 1400 ducks and geese were killed. The H5N1 virus affects birds mainly chickens and turkeys, but also water birds such as ducks and geese.
German

?
English

Translate
 
Re: H5N1 returns to Germany

not infected with H5N1

http://www.sz-online.de/nachrichten/artikel.asp?id=1986278
Click to expand...

credits gsgs

machinetranslation

Dead swan in Dauban not with bird flu virus

- snip -

Goerlitz - The weekend in Dauban Goerlitz in the county discovered dead swan is not the bird flu virus. It announced on Wednesday morning with the county Goerlitz. The Saxon Investigation Institute in Dresden conducted test on the dangerous influenza virus type H5N1 was negative.
 
You must log in or register to reply here.
Back
Top Bottom