• FluTrackers.com Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster. The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website. By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
  • We are not asking for any donations. Do not donate to any entity who says they are raising funds for us.

mallards

gsgs

Registered User
flu-evolution in mallards is different from that in poultry or mammals

flu in mallards (and pintails,shovelers,teals,widgeons,guillemots,...)
have an almost fixed amino-acid sequence in the inner segments.
It presumably dominantly spreads by water and often developes fewer
nucleotide mutations as well.
So the calculations to examine most-recent-common-ancestor-dates
from mallard-sequences are to be taken carefully.
You often won't see the typical mutation-acquiring behaviour that
we are used to see from mammalean or poultry flu.
(see e.g. the thread about slow evolution in Chinese birds)

flu usually goes from mallards to other species, where it my set foot
and evolve (i.e. in the inner segments) separately for decades,centuries
and then die out, to get replaced by new (mallard-) strains.

We have no example that flu went back from poultry or mammals
to mallards in an evolution changing manner.
Mallards maintain their own, fundamental, index-close sequences
in the inner segments and a big variety in the 16 HAs and 9 NAs
and frequent reassortments. Occasionally (~~once per century ?)
west-mallard-flu (America) mixes with East-mallard-flu (Europe,Asia,
Oceania,Africa), but typically they are separated
These mixing events are potentially dangerous in forming
reassortments and new pandemic strains.

--------------------------------------------
searching pubmed for influenza,evolution,mallards
-----------------------------------------------------------
Phylogenetic analyses confirm two mitochondrial mallard clades. Genetic differentiation
within Eurasia and North-America is low, on a continental scale, but large differences
occur between these two land masses (F(ST) = 0.51).
a split between Eurasia and North-America 43,000 to 74,000 years ago
and strong population growth (~100fold) since then and little migration
(not statistically different from zero).
Based on this first complete assessment of the mallard's world-wide population genetic
structure we confirm that no more than two mtDNA clades exist. Clade A is characteristic
for Eurasia, and clade B for North-America although some representatives of clade A are
also found in North-America.
---------------------------------------------------
(Minnesota,H3N8,H4N6)
The viruses persisted in water for an extended time period at constant temperature
(several weeks) but infectivity rapidly reduced under multiple freeze-thaw cycles
----------------------------------------------------
A/mallard/Poland/446/09 (detected in December 2009) shared a recent common ancestor with
A/mallard/Poland/41/09 (isolated in February 2009) in relation to HA and PB1 genes, with
A/mallard/Poland/16/09 (found in January 2009) regarding NA and NS genes, and with
A/mallard/Poland/01/08 (recovered in December 2007) as regards the NS gene. Interestingly,
A/mallard/Poland/16/09 and A/mallard/Poland/446/09 were isolated at the same sampling site almost
exactly 1 year apart, which points to resident population of mallards (and other resident waterfowl)
---------------------------------------------------------------

they should test normal current human-flu viruses HA,NA, also H5N1 and the 6 inner segments from
the mallard-index in ferrets
5,1,3,2,1,1 A/NL/219/2003(H7N7)
8,7,10,9,7,5 A/BM/1/1918(H1N1)


--------------------------------------------------------------------------------------

http://www.ncbi.nlm.nih.gov/pubmed/22859590
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3335010/

A/Mallard/MN/Sg-00169/2007 (H3N8); A/Mallard/MN/Sg-00219/2007 (H4N8); A/Mallard/MN/Sg-00170/2007 (H6N1); A/Mallard/MN/Sg-00107/2007 (H6N2); A/Green-winged teal/MN/Sg-00197/2007 (H6N8) (referred to hereafter as their respective subtype). Relative abundance of the five virus subtypes (i.e. prevalence ± 95% confidence intervals) in the waterfowl population at the sampling site was 22.5 ± 9.7% (H3N8), 9.9 ± 6.9% (H6N1), 5.6 ± 5.4% (H6N2), 2.8 ± 3.9% (H6N8) and 1.4 ± 2.7% (H4N8) (cf. [27] for details).

13,3322,0,2,7,2,-,2
23,3365,5,3,6,2,1,6
13,3295,1,2,8,1,-,-*
15,3298,0,4,6,2,-,-*
18,3335,2,2,4,1,7,-

--------------------------------------------------------
 
Re: mallards

ducks in Asia
==========

http://www.ncbi.nlm.nih.gov/pubmed/23637797
strong tendency for long-lasting hemagglutinin-related homosubtypic immunity in mallards
-------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/22486512
mallards:134 haplotypes
No geography, breed or population clusters in Eurasian domestic ducks and mallards.
5 haplotypes were shared by USA mallards and Eurasian domestic duck/Eurasian mallards.
1 haplotype (H49) was shared by Eurasian ducks and China spot-billed ducks.
(i) Eurasian and North American mallards show a clear geographic distribution pattern;
(ii) Eurasian domestic ducks are derived from the Eurasian mallards, not from the spot-billed ducks.
-----------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/20674751
China is particularly rich in duck genetic resources.
low genetic diversity of Chinese domestic ducks
Chinese domestic ducks mainly derived from mallards, few from spot-billed duck
----------------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/20943331
mortality of several H5N1 in Vietnam Muscovy ducks > 80%, 0%-100% in mallards
high titers in muscovy brains
------------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/20521725
Live Bird Markets in Korea during the winter seasons of 2006-08.
Phylogenetic analysis suggests that the Korean H9N2 viruses prevalent in chickens
have provided their gene segments to AIVs circulating in ducks
------------------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/20382820
mortality of H5N1 in 5 migratory species : mute swans(100%),greylag geese(0%,but severe),
ruddy shelducks(100%),mandarin ducks(~5%),mallards(asymptomatic)
-------------------------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2837633/
avian flu in Iran (mainly Kaspian sea area) : Mallard(43%), Common Teal(26%), Common Pochard,
Northern Shoveler and Eurasian Wigeon
---------------------------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/19937535
differences in H5N1 pathogenicity in mallards induced by HA-cleavage site ?
----------------------------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/19267595
tracking mallards wintering in Japan
typically stayed 1-4 weeks at a site between migration intervals of 2-3 days.
Stopover sites: NE-Japan, E-Korea,farE-Russia.
terminal breeding sites in NEAsia and farE-Russia
----------------------------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/19160826
mallards Heilongjiang Oct. 2006
H2N2:2,H2N6:2,H3N4,H3N6:2,H3N7:2,H3N8:2,H6N2:2,H11N2,H11N3,H11N5:2,H11N6,garganey-H5N2
------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/18957137
China, has 30 unique breeds diverse duck genetic pool
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2586638/
All domestic duck and wild mallard haplotypes were essentially indistinguishable
and were clustered together in the phylogenetic tree. There was no geographic
differentiation and breed/population-specific distribution of duck lineages.
------------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/18394278
tufted ducks, Eurasian pochards, and mallards excreted significantly more virus
than common teals, Eurasian wigeons, and gadwalls; yet only tufted ducks and,
to a lesser degree, pochards became ill or died.
-------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/16103179
juvenile mallards with 23 different H5N1, replicated well, 22 transmitted
trachea more than cloaca
-------------------------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/15078970
new 2002-H5N1 caused systemic infection in ducks, with high titers and multiorgan pathology,i.e. brain.
High titers in the birds' drinking water. In contrast, H5N1 1997-2001 were not well transmitted and
did not cause significant disease.
-------------------------------------------------------------------------------------------
1980-1983,San-in W-Japan
8/354 faeces whistling swans; 0/261 black-tailed gulls, 0/113 pintails ,0/10 mallards
5/8 H2, 2 H7, 1 H4
H13N1,H11N6 from 465 fecal samples from pintails, 0/255 whistling swans, 0/625 black-tailed gulls
17/1156 , 10 H7N3, 2 H1N6 and 2 H3N8, from 459 whistling swans. 2, H13N3 and H13N6
2/425 black-tailed gulls. 1/30 H1N3 mallards 0/242 pintails.
----------------------------------------------------------------------
 
Re: mallards

mallard genome
----------------

.pdf here: http://www.nature.com/ng/journal/vaop/ncurrent/pdf/ng.2657.pdf

anas platyrhynchos is the mallard. ---10-week-old female Beijing duck ----
We were wondering whether the Asian domestic ducks were different
in that they can get viruses that evolved away from the index,
which we didn't see in North American mallards.
Well, it could just be because domestic ducks or commercial ducks
are not popular in North America.

http://www.ncbi.nlm.nih.gov/bioproject/?term=PRJNA46621


ftp://ftp.ncbi.nih.gov/genbank/geno..._platyrhynchos/BGI_duck_1.0/Primary_Assembly/

I didn't find the chromosomes in fasta-format yet
I'm not sure whether and when they will be available.

Do I understand correctly, that they have influenza-specific genes, which evolved
since mallards get influenza ? But that's supposed to be only some thousand years ?!?
While DNA changes are more slowly. When we dig out the bones of a mallard that died
>10000 years ago, might that show us whether mallards got flu 10000 years ago ?

phylo of Eurasian ducks:
http://www.ncbi.nlm.nih.gov/pubmed/22988769
Anas zonorhyncha in Asia, "spot billed duck"

mitochondrial DNA was published earlier:
http://www.ncbi.nlm.nih.gov/nuccore/154125702
paper: http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2586638/


5 full mitochondrial mallard sequences at genbank:
Code:
                00000234799999901245 
                12226297402236804053 
                91770469426790278049 
                79127433171163463283 
---Index--------ACCCTTATGTACAGACACCG 
 1 > EU009397   .TT.C............... 
 2 > EU755252   .....C....GTGAGG.... 
 3 > EU755253   G..T.CG....TG...GTTA 
 4 > FJ167857   .......CAC.......... 
 5 > HM010684   .......C.C..........
 
Re: mallards

(beta-defensin and butyrophilin genes in ducks could be responsible for their better
immunity against influenza

http://en.wikipedia.org/wiki/Beta_defensin
Every mammalian species explored thus far has beta-defensins.
β-defensins genes are found in the genome of both ostrich and mammalians.[8]

http://en.wikipedia.org/wiki/Butyrophilin
gene on chromosome 6

http://www.ncbi.nlm.nih.gov/pubmed/19851734
(2009) a novel avian beta-defensin (AvBD) was isolated from duck pancreas
64aa: MRILYLLFSVLFLVLQVSPGLSLPQRDMFLCRIGSCHFGRCPIHLVRVGSCFGFRSCCKSPWDV

http://www.plosone.org/article/info:doi/10.1371/journal.pone.0047743
5 new beta defensins in ducks: June 2012
198 bp, 182 bp, 201 bp, 204 bp, and 168 bp, and encoded 65, 60, 66, 67, and 55 amino acids,

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3133436/

-------from above, differences in duck species wrt. H5N1 pathogenicity--------
yet only tufted ducks and, to a lesser degree, pochards became ill or died.
mortality of H5N1 : mandarin ducks(~5%),mallards(asymptomatic)
mortality of several H5N1 in Vietnam Muscovy ducks > 80%, 0%-100% in mallards
high titers in muscovy brains
---------------------------------------------------------------
HP H7N1 (NL03?) bad in chickens, asympt. in ducks, lung,brain,spleen
chickens: IL-6 and IL-1β mRNA
ducks: quicker but lower IL-6, IL-1β and iNOS
ducks: CVI-ChNL-68.1+ , CD4+ and CD8α+ cells and apoptosis at 8 hpi
excessive delayed cytokine inflammatory responses but inadequate cellular immune
responses may contribute to pathogenesis in chickens
---------------------------------------------------------------------
(received Sep.2010)
at the time when our study had started, genome sequencing of the domestic duck genome
and de novo assembly was in progress and almost completed by the Beijing Genome Institute (BGI).
(Huang et.al

http://www.biomedcentral.com/1471-2164/12/150

Almost all of the varieties of domesticated ducks are descended from the Mallard
(Anas platyrhynchos), apart from the Muscovy Duck (Cairina moschata).[1][2]
-------------------------------------------------------------------------
http://www.ncbi.nlm.nih.gov/pubmed/23876184
Domestic ducks have been recognized as one of the primary factors in the spread of H5N1 HPAI.

pathogenicity of H5N1 in Muscovy ducks (Cairina moschata) gave more severe disease
than various breeds of Anas platyrhynchos var. domestica ducks including Pekin,
Mallard-type, Black Runners, Rouen, and Khaki Campbell ducks.
----------------------------------------------------------------------------
 
Back
Top Bottom