• FluTrackers.com Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster. The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website. By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
  • We are not asking for any donations. Do not donate to any entity who says they are raising funds for us.

The 12th Protein (N40): Identification of a Novel PB1-Related Protein Translated from Influenza A Virus Segment 2 mRNA

mixin

Well-known member
Influenza A virus segment 2 is known to encode two polypeptides in overlapping open reading frames: PB1, the polymerase, and PB1-F2, a proapoptotic virulence factor. We show that a third major polypeptide is synthesized from PB1 mRNA via differential AUG codon usage. PB1 codon 40 directs translation of an N-terminally truncated version of the polypeptide (N40) that lacks transcriptase function but nevertheless interacts with PB2 and the polymerase complex in the cellular environment.

Importantly, the expression of N40, PB1-F2, and PB1 are interdependent, and certain mutations previously used to ablate PB1-F2 production affected N40 accumulation. Removal of the PB1-F2 AUG upregulated N40 synthesis, while truncating PB1-F2 after codon 8 (with a concomitant M40I change in PB1) abolished N40 expression. A virus lacking both N40 and PB1-F2 replicated normally. However, viruses that did not express N40 but retained an intact PB1-F2 gene overexpressed PB1 early in infection and replicated slowly in tissue culture.

Thus, the influenza A virus proteome includes a 12th primary translation product that (similarly to PB1-F2) is nonessential for virus viability but whose loss, in particular genetic backgrounds, is detrimental to virus replication.

http://jvi.asm.org/cgi/content/abstract/83/16/8021
 
Re: The 12th Protein (N40): Identification of a Novel PB1-Related Protein Translated from Influenza A Virus Segment 2 mRNA

AUG is ATG, amino acid M, the start of a protein

PB1-F2 starts at nucleotide 95 , amino acid #32
in the frame one nucleotide more than PB1

N40 starts at amino acid 40 ?


------------------------

Code:
>A/Mexflu/index/2009-02-01
PB1,758,
MDVNPTLLFLKIPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGKWTTNTETGAP...
1        .         .         .         .40

PB1-F2,91,
MEQEQDTPWTQ}TEHTNTQKRESGRQTQRLVHPSSTRLMDHYLRIMNQVGMHKQTVF}RLWLSLKNPTQEYLRIHALKQWKLFNKQG}IN}



>A/Brevig Mission/1/1918(H1N1)
PB1,758,
MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGRWT...
         .         .         .         .40

PB1-F2,91,MGQEQDTPWILSTGHISTQKREDGQQTPRLEHHNSTRLMDHCQKTMNQVVMPKQIVYWKQWLSLRSPTPVSLKTRVLKRWRLFSKHEWTS}





>A/Mexflu/index/2009-02-01
segment 2,reading frame +2
GCQSDSTFPKNSSAKCHKHHIPLYWRSSIQPWNRNRIHHGHSKQNTPILRKGKVDDKHRDWCTPAQPD}WTTT}G}}TKWVCTNRLCSRGYGFP}RIPPRNI}EFMP}NNGSCSTNKGR}TNSRSPDL}LDIKQKSTGSNCIGQHHRSL}IEWPNS}}VRKANRFLKGCNGINEQRGNRDNNPLSKKKESKRQHDQEDGHAKNNREEKTKTE}ERLSNKSTDIKYDDQRCRERQVKKKGYRNTWDAD}RFRILC}NFS}EHLRKA}TVWAPSRGQ}KEGQTGKCCEKDDD}FTRHRDFFHNHWGQH}VE}KSKSSNVPGDDYIYHQKSTRVVQKHPEHGTHNVLKQNGKTRERVHVRE}KNEDSNTNTSRNASKH}PEVLQ}INKEEN}ENKASSNRWHSITESWDDDGHVQHAKYGLGSLDTESWTKEIHQDNILVGWAPIIRRFCSHSECTKP}GNTSRSGQILQDLQVSGNQHEQKEVLYK}DRDI}IHKLFLSLWICG}F}HGATQLWSVWSK}IS}HEYWSNSDKEQHDKQ}PWTCNGPDGSSIVHQRLQIHI}VP}GRHTNSDEKII}VKEAVGSNPIKGRAISIRWRTKLIQYTESSHS}SLLKMGANG}}LSGKTL}SPESLCQS}RD}FCKQCCGNASPWSSQKHGI}CRCNYTFLDSQEESFYSQHKPKGNS}G}TDVPEVLQSIREIFP}QFI}ETGWNF}HGGGHGV}GPD}CQGRLRVWTDQERRVL}DHEDLFHH}RTQTAKI-
         .         .         .         .

>A/Brevig Mission/1/1918(H1N1)
segment 2, reading frame +2
GCQSDFTFLESASAKCYKHNVPLYWRPSLQPWDRNRIHHGYCQQDTSVLRKGKMDNKHRDWSTTTQPD}WT...
 
Re: The 12th Protein (N40): Identification of a Novel PB1-Related Protein Translated from Influenza A Virus Segment 2 mRNA

AUG is ATG, amino acid M, the start of a protein

PB1-F2 starts at nucleotide 95 , amino acid #32
in the frame one nucleotide more than PB1

N40 starts at amino acid 40 ?

The M (methionine) is usually at position 40 of PB1 as well, so the N40 must just be the name of the 12th protein.
 
Re: The 12th Protein (N40): Identification of a Novel PB1-Related Protein Translated from Influenza A Virus Segment 2 mRNA

Is this loss something you can see in a sequence or is it something that only shows up under a microscope?
 
Re: The 12th Protein (N40): Identification of a Novel PB1-Related Protein Translated from Influenza A Virus Segment 2 mRNA

Is this loss something you can see in a sequence or is it something that only shows up under a microscope?

I have ocassionally seen PB1 position 40 with an "L" instead of the normal "M", but I do not know its significance.

As to whether the F2 protein codes in PB1 you can look at the sequence at the nucleoid level, one reading frame up, and look for a stop condon between positions 94 and 355. If no "taa" found, then one would presume that the protein could otherwise be fully formed. If a stop condon was found, then the protein might only be partially formed (truncated), or not at all.
 
Re: The 12th Protein (N40): Identification of a Novel PB1-Related Protein Translated from Influenza A Virus Segment 2 mRNA

sequences with M40I in PB1, only these few:

>A/chukkar/Shantou/89/05(H6N1)
>A/chukkar/Shantou/1530/05(H6N1)
>A/Gs/Shantou/18442/05(H5N1)
>A/Ck/Laos/P0171/07(H5N1)
>A/Dk/Nong-Khai/THA/KU-56/07(H5N1)
>A/Ck/Hunan/774/02(H9N2)
>A/Ck/Shantou/2994/04(H9N2)
>A/Ck/Shantou/7920/04(H9N2)
>A/pheasant/Shantou/111/05(H9N2)
>A/Ck/Shantou/55/05(H9N2)
>A/partridge/Shantou/7936/04(H9N2)
>A/silky Ck/Shantou/3581/05(H9N2)
>A/silky Ck/Shantou/1826/04(H9N2)
>A/Ck/Shantou/1926/04(H9N2)
>A/Ck/Shantou/2692/04(H9N2)
>A/turkey/Shantou/1915/04(H6N2)
>A/partridge/Shantou/1913/04(H6N2)
>A/Ck/Shantou/19465/05(H9N2)
>A/Dk/Germany/1215/1973(H2N3)
>A/Ck/Italy/322/01(H7N1)
>A/turkey/Italy/1351/01(H7N1)
>A/silky Ck/Korea/S3/03(H9N2)
>A/Ck/HK/739/94(H9N2)
>A/N.pintail/Alaska/44204-075/06(H3N8)
>A/Ck/Chis/15224/97(H5N2)
>A/NY/123/04(H3N2)
>A/Canterbury/96/00(H3N2)
>A/Canterbury/92/00(H3N2)
>A/Canterbury/97/00(H3N2)
>A/Canterbury/61/02(H3N2)
>A/Ontario/1252/07(H3N2)
>A/Sw/Alberta/56626/03(H1N1)
>A/Sw/Iowa/2/1987(H1N1)
>A/Sw/Tennessee/23/1976(H1N1)
>A/Sw/Tennessee/48/1977(H1N1)
>A/Sw/Ontario/57561/03(H1N1)
>A/Sw/Saitama/96(H1N2)
 
Re: The 12th Protein (N40): Identification of a Novel PB1-Related Protein Translated from Influenza A Virus Segment 2 mRNA

Gibbs says it's in the same reading frame as PB1 (+0)
while PB1-F2 is +1
 
Back
Top Bottom